Recombinant Innexin unc-9 (unc-9)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Function

Recombinant Innexin UNC-9 is derived from the unc-9 gene, which encodes an innexin protein critical for forming gap junctions in C. elegans. Unlike vertebrate connexins, innexins mediate electrical and chemical coupling in invertebrates. Key features include:

  • Structural role: Forms intercellular channels for ion and small molecule exchange .

  • Tissue-specific expression: Localized to body-wall muscles, neurons (e.g., RMG hub circuit, GABAergic motor neurons), and glia .

  • Functional diversity: Supports both channel-dependent electrical coupling and channel-independent roles in synaptic patterning .

Electrical Coupling in Muscle and Neurons

  • Body-wall muscle synchronization:

    • UNC-9 collaborates with INX-1, INX-10, INX-11, INX-16, and INX-18 to mediate electrical coupling. Loss of unc-9 reduces junctional current (I_j) by ~30% .

    • Rescue experiments confirm UNC-9 functions cell-autonomously in muscle .

Innexin MutantJunctional Current (I_j) DeficitRescue by Muscle-Specific Expression
unc-9(lf)~30% reductionFull restoration of I_j
inx-1(lf)~20% reductionYes
  • Neuronal circuits:

    • In the RMG hub-and-spoke circuit, UNC-9 gap junctions regulate aggregation behavior, foraging speed, and responses to oxygen/pheromones .

    • unc-9 mutants suppress social behaviors in npr-1(lf) strains, highlighting its role in sensorimotor integration .

Channel-Independent Roles

  • Synaptic tiling:

    • UNC-9 ensures minimal overlap of presynaptic domains in GABAergic motor neurons. This function is independent of its channel activity, as shown by rescue experiments with channel-dead mutants .

    • Localizes to presynaptic tiling borders, interacting with Wnt signaling pathways .

Modulation by Accessory Proteins

  • UNC-1 (stomatin-like protein) regulates UNC-9 gap junction gating. Co-localization and genetic interactions suggest a functional partnership in muscle synchronization .

Expression and Localization

  • Promoter-driven expression:

    • Detected in body-wall muscles (via myo-3 promoter) and neurons (via npr-1 and flp-21 promoters) .

    • GFP-tagged UNC-9 localizes to intercellular junctions in muscles and neuronal processes .

TissueExpression LevelLocalization Pattern
Body-wall muscleHighPunctate junctions
RMG hub neuronsModerateGap junctions with sensory neurons
GABAergic motor neuronsHighPresynaptic tiling borders

Applications in Research

  • Circuit dissection:

    • Dominant-negative unc-1(dn) transgenes and Cre-Lox systems selectively disrupt UNC-9 gap junctions, enabling precise circuit analysis .

  • Behavioral studies:

    • unc-9 mutants exhibit locomotion defects and impaired aggregation, linking gap junctions to social behavior .

Notable Mutant Phenotypes

PhenotypeMechanismCitation
Reduced muscle coordinationImpaired electrical coupling
Loss of aggregation behaviorDisrupted RMG hub circuit signaling
Presynaptic overlapChannel-independent tiling defect

Technical Advances

  • Rescue constructs:

    • UNC-9::GFP and UNC-9::mTagBFP2 fusions restore function in mutants while enabling visualization .

  • Dominant-negative tools:

    • unc-1(dn) disrupts UNC-9 activity without affecting chemical synapses, distinguishing electrical vs. synaptic contributions .

Open Questions

  • How does UNC-9 interact with other innexins (e.g., INX-18, UNC-7) in composite gap junctions?

  • What structural domains mediate its channel-independent role in synaptic tiling?

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please specify your desired tag type if applicable, and we will prioritize its development.
Synonyms
unc-9; R12H7.1; Innexin unc-9; Uncoordinated protein 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
unc-9
Target Protein Sequence
MSMLLYYFASAVKSIQFHVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPAT FTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAERENRQIGYYQWVPFVLALEALLFYVPT IVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLK LLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGR EWEESGHFPRVTLCDFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCS LFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAG ELPCYELAKTLWNNYCDNKEGKMHDV
Uniprot No.

Target Background

Function
UNC-9 is a structural component of gap junctions and plays a crucial role in maintaining gap junction activity to facilitate locomotion.
Gene References Into Functions
  1. UNC-9 plays a significant role in neuromuscular transmission. PMID: 16434400
  2. UNC-9 exhibits perisynaptic localization throughout development and is essential in presynaptic neurons for regulating active zone differentiation. PMID: 19386917
  3. UNC-7S and UNC-9 are broadly expressed and contribute to a substantial number of gap junctions identified in the locomotory nervous system. PMID: 19432959
Database Links

KEGG: cel:CELE_R12H7.1

STRING: 6239.R12H7.1

UniGene: Cel.19695

Protein Families
Pannexin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Expressed in PLM neurons (at protein level). Expressed in the nerve ring.

Q&A

What is UNC-9 and what is its primary function in C. elegans?

UNC-9 is a gap junction protein (innexin) essential for electrical coupling between neurons in Caenorhabditis elegans. It forms channels that allow direct communication between cells through the passage of ions and small signaling molecules. UNC-9 plays a critical role in a hub-and-spoke neural circuit that regulates social aggregation and related behaviors in C. elegans, with the RMG neurons serving as hub neurons that connect to various sensory spoke neurons . The proper functioning of UNC-9-containing gap junctions is necessary for the coordination of behavioral responses to environmental stimuli such as oxygen, pheromones, and food.

How does UNC-9 differ from other innexin proteins in C. elegans?

While UNC-9 is one of several innexins in C. elegans, it has unique functional properties. Studies have shown that UNC-9 works cooperatively with UNC-18 to form one population of gap junctions, while four other innexins (INX-1, INX-10, INX-11, and INX-16) appear to form a separate, distinct population . Junctional conductance (Gj) measurements demonstrate that UNC-9 makes a larger contribution to electrical coupling than some other innexins, as mutations in unc-9 cause more severe defects in electrical coupling compared to mutations in some other innexin genes . Additionally, UNC-9 has a unique channel-independent function in controlling synaptic tiling that has not been demonstrated for other innexins .

What phenotypes are associated with unc-9 mutations in C. elegans?

Mutations in the unc-9 gene result in multiple behavioral defects:

  • Disrupted social aggregation behavior in npr-1 mutant backgrounds

  • Altered locomotion (uncoordinated phenotype)

  • Defects in responses to environmental stimuli such as oxygen and pheromones

  • Abnormal tiling of presynaptic regions in GABAergic motor neurons

  • Reduced electrical coupling between body-wall muscle cells and between neurons

In electrophysiological recordings, unc-9 mutants (such as unc-9(e101) and unc-9(fc16)) show significantly reduced junctional currents (Ij) between coupled cells compared to wild-type animals, demonstrating the essential role of UNC-9 in electrical coupling .

How can I selectively inhibit UNC-9 gap junction function in specific neurons?

To selectively inhibit UNC-9 gap junction function in specific neurons, you can use several complementary approaches:

  • Dominant-negative UNC-1 expression: Express dominant-negative versions of the UNC-1 stomatin protein (unc-1(dn) or unc-1(n494)) under cell-specific promoters. UNC-1 regulates UNC-9 electrical signaling, and dominant-negative forms disrupt UNC-9-based gap junctions .

  • Cre-Lox system: Use a conditional knockout approach with the Cre-Lox system to delete unc-9 in specific cells. This involves generating a strain with loxP sites flanking the unc-9 gene and expressing Cre recombinase under cell-specific promoters. For example, flp-5::Cre can target RMG neurons, while flp-8::Cre can target URX neurons .

  • Cell-specific rescue: In an unc-9 mutant background, express wild-type UNC-9 under cell-specific promoters to determine which cells require UNC-9 for normal function .

When designing these experiments, it's important to include appropriate controls and confirm the specificity of your manipulations using electrophysiological recordings or behavioral assays.

What methods can be used to monitor UNC-9 gap junction function in vivo?

Several techniques can be employed to monitor UNC-9 gap junction function in living organisms:

  • Dual whole-cell voltage-clamp recordings: This is the gold standard for directly measuring electrical coupling. It allows measurement of junctional currents (Ij) between two coupled cells by holding one cell at a constant voltage while applying voltage steps to the neighboring cell . The junctional conductance (Gj) can be calculated from the slope of the linear portion of the Ij-Vj curve.

  • Calcium imaging: Since gap junctions can mediate the spread of calcium signals, calcium indicators like GCaMP can be used to visualize the propagation of activity between coupled neurons.

  • Dye coupling assays: Inject a gap junction-permeable fluorescent dye into one cell and observe its spread to coupled cells over time.

  • Behavioral assays: Monitor behaviors known to depend on UNC-9 function, such as aggregation in npr-1 mutants or responses to environmental stimuli .

  • Electrophysiological recording of neuronal responses: Record from neurons known to be coupled by UNC-9-containing gap junctions and compare responses to stimuli in wild-type and unc-9 mutant backgrounds .

How can I generate and validate a channel-inactive UNC-9 for studying non-channel functions?

To generate and validate a channel-inactive UNC-9 for studying non-channel functions:

  • Generation of channel-inactive UNC-9:

    • Create an N-terminal deletion construct removing the first 18 amino acids (UNC-9(ΔN18)). This modification eliminates channel function while preserving other protein functions .

    • Clone this construct into an appropriate expression vector under the control of cell-specific promoters.

    • Generate transgenic animals expressing the UNC-9(ΔN18) construct.

  • Validation methods:

    • Electrophysiological validation: Perform dual whole-cell voltage-clamp recordings between cells expressing UNC-9(ΔN18) to confirm the absence of junctional currents. Compare to wild-type UNC-9 and unc-9 null mutants .

    • Functional assays: Test whether UNC-9(ΔN18) rescues non-channel phenotypes (like presynaptic tiling in GABAergic neurons) but fails to rescue channel-dependent phenotypes (like electrical coupling) .

    • Localization assays: Confirm that UNC-9(ΔN18)::GFP localizes similarly to wild-type UNC-9::GFP at cell junctions, demonstrating that the protein is properly expressed and transported.

In a study by Liu et al., UNC-9(ΔN18) was shown to completely lack intra-quadrant electrical coupling similar to unc-9(e101) mutants (as measured by junctional current), while still maintaining the ability to control tiled presynaptic patterning between DD5 and DD6 neurons .

How do I analyze junctional current data to assess UNC-9 gap junction function?

To analyze junctional current data for assessing UNC-9 gap junction function:

  • Measuring junctional currents (Ij):

    • Perform dual whole-cell voltage-clamp recordings on coupled cells.

    • Hold one cell at a constant voltage (e.g., -30 mV) while applying voltage steps to the other cell (e.g., from -110 to +50 mV at 10 mV intervals).

    • Record the resulting currents in the first cell, which represent junctional currents (Ij) .

  • Data analysis steps:

    • Plot the Ij-Vj relationship (junctional current vs. transjunctional voltage).

    • Calculate junctional conductance (Gj) from the slope of the linear portion of the Ij-Vj curve.

    • Compare Gj values between experimental groups (e.g., wild-type, mutants, rescue lines).

    • Use appropriate statistical tests (e.g., t-tests or ANOVA with post-hoc tests) to determine significant differences between groups.

  • Interpretation guidelines:

    • A steep slope in the Ij-Vj curve indicates high junctional conductance and strong coupling.

    • Complete absence of junctional current indicates lack of functional gap junctions.

    • Partial reduction in junctional current may indicate fewer gap junctions or altered channel properties.

    • Consider the possibility of compensatory mechanisms or redundancy with other innexins when interpreting results .

How do I address contradictions in UNC-9 research data?

When facing contradictory results in UNC-9 research:

  • Systematic troubleshooting approach:

    • Examine experimental conditions closely for variations that might explain the discrepancies.

    • Consider genetic background differences that might influence UNC-9 function.

    • Evaluate whether different cell types or developmental stages were examined.

    • Check for potential off-target effects of genetic manipulations.

  • Reconciliation strategies:

    • Perform side-by-side comparisons using standardized conditions.

    • Use multiple, complementary approaches to test the same hypothesis.

    • Examine whether UNC-9 functions differently in different cellular contexts.

    • Consider the involvement of other innexins that might compensate for UNC-9 loss .

  • Interpretation framework:

    • Look for patterns in the data rather than focusing on individual contradictory results.

    • Consider alternative models that could explain the full range of observations.

    • Recognize that contradictions often lead to new insights about complex biological systems .

For example, when studying the role of UNC-9 in neuronal connectivity, researchers have encountered data suggesting both electrical and chemical synapse involvement. These apparent contradictions have been resolved by recognizing that UNC-9 plays distinct roles in different neuronal subtypes and that electrical and chemical synapses can work together in the same circuit .

What controls should be included when studying UNC-9 function in genetic experiments?

When designing genetic experiments to study UNC-9 function, include these essential controls:

  • Genetic background controls:

    • Wild-type animals for baseline comparison

    • unc-9 null mutants as negative controls

    • Heterozygous animals to assess dosage effects

    • Multiple independent unc-9 alleles to confirm phenotype specificity

  • Rescue experiment controls:

    • Cell-specific rescue with wild-type UNC-9 to determine site of action

    • Expression level controls (using standardized promoters)

    • Empty vector controls for transgenic experiments

    • UNC-9 expression in non-relevant cells as a specificity control

  • Molecular manipulation controls:

    • Testing dominant-negative constructs (like UNC-1(dn)) in wild-type backgrounds to confirm specificity

    • Rescuing dominant-negative effects with gain-of-function UNC-9::GFP to validate the approach

    • When using UNC-9(ΔN18), confirm channel inactivity with electrophysiological recordings

  • Phenotypic assessment controls:

    • Testing multiple behaviors or cellular phenotypes known to depend on UNC-9

    • Including positive controls for phenotypic assays (e.g., other mutants with known effects)

    • Blind scoring of phenotypes to avoid bias

For example, when studying channel-independent functions of UNC-9, researchers validated their UNC-9(ΔN18) construct by confirming it could not rescue electrical coupling in muscle cells but could rescue presynaptic tiling, demonstrating both the specificity of the manipulation and the dissociation of these two functions .

How does UNC-9 contribute to neuronal circuit function in a channel-independent manner?

UNC-9 has been found to contribute to neuronal circuit function through channel-independent mechanisms:

  • Synaptic tiling regulation:
    UNC-9 plays a crucial role in controlling the tiled arrangement of presynaptic regions in GABAergic motor neurons, where axons and synapses overlap minimally with neighboring neurons of the same class. Specifically:

    • UNC-9 localizes at the presynaptic tiling border between neighboring dorsal D-type GABAergic motor neurons .

    • The N-terminal deletion variant UNC-9(ΔN18), which lacks gap junction channel activity, still maintains the ability to control tiled presynaptic patterning .

    • This function appears to be distinct from axonal tiling, which is controlled by EGL-20/Wnt signaling .

  • Molecular mechanisms:

    • UNC-9 may function as a scaffolding or adhesion molecule that defines synaptic territories.

    • It might interact with cytoskeletal components or synaptic organizing molecules to establish boundaries between adjacent neurons.

    • UNC-9 could potentially participate in cell-cell signaling pathways independent of its channel function.

  • Implications for circuit development:

    • This channel-independent function contributes to precise spatial arrangement of synaptic connections, which is essential for proper nervous system function.

    • The discovery suggests that gap junction proteins may play multifaceted roles in neural circuit development beyond their canonical function as electrical synapses.

This research provides important insights into the diverse functions of innexin proteins and challenges the conventional view that gap junction proteins act primarily as channels .

How do multiple innexins interact to form functional gap junctions in C. elegans?

The formation of functional gap junctions in C. elegans involves complex interactions between multiple innexins:

This research highlights the complexity of gap junction composition and suggests that different innexins may contribute to channels with distinct properties or functions within the same tissue.

What techniques can be used to integrate UNC-9 research with broader studies of neural circuit function?

Integrating UNC-9 research with broader neural circuit studies requires sophisticated approaches:

  • Combinatorial genetic approaches:

    • Combine UNC-9 manipulations with optogenetic or chemogenetic tools to simultaneously control gap junction and chemical synaptic function.

    • Use temporally controlled expression systems (heat-shock promoters or drug-inducible systems) to manipulate UNC-9 function at specific developmental time points .

    • Apply intersectional genetic strategies to target UNC-9 manipulations to specific subsets of cells within a circuit.

  • Advanced imaging techniques:

    • Implement volumetric calcium imaging to visualize activity propagation through UNC-9-coupled circuits.

    • Use super-resolution microscopy to visualize the nanoscale organization of UNC-9-containing gap junctions.

    • Apply correlative light and electron microscopy to relate UNC-9 localization to ultrastructural features of gap junctions.

  • Computational modeling:

    • Develop computational models of electrical coupling in UNC-9-containing circuits.

    • Use these models to predict circuit-level effects of UNC-9 manipulations.

    • Test model predictions with experimental manipulations to refine understanding of UNC-9's role in circuit function.

  • Multi-modal experimental design:

    • Combine electrophysiological recordings with behavioral assays to relate cellular UNC-9 function to organismal behavior.

    • Use systematic behavioral profiling to comprehensively assess the effects of UNC-9 manipulations.

    • Implement closed-loop systems where animal behavior triggers real-time optogenetic manipulation of UNC-9-containing circuits.

For example, researchers investigating the role of UNC-9 in social aggregation have combined cell-specific genetic manipulations with detailed behavioral analysis and calcium imaging to understand how information flows through the hub-and-spoke circuit that controls this behavior .

How conserved are the functions of UNC-9 across innexin/pannexin families?

The functions of UNC-9 show interesting evolutionary conservation across innexin and pannexin families:

This conservation suggests that findings from UNC-9 research in C. elegans may have broader implications for understanding the diverse functions of pannexins and connexins in vertebrate systems, including potential roles in neuronal development and circuit function.

What role does UNC-9 play in neuronal plasticity and learning?

While direct evidence for UNC-9's role in learning and plasticity is still emerging, several lines of research suggest important contributions:

  • Gap junctions and neural plasticity:

    • Gap junctions can modify neuronal excitability and synchrony, which are critical for certain forms of plasticity.

    • The electrical coupling mediated by UNC-9 may influence the integration of synaptic inputs and modulate Hebbian plasticity mechanisms.

    • Activity-dependent regulation of gap junction coupling could serve as a form of plasticity complementary to chemical synaptic plasticity.

  • Potential mechanisms:

    • UNC-9 gap junctions might facilitate the spread of second messengers involved in plasticity, such as calcium or cAMP.

    • The channel-independent functions of UNC-9 could influence the structural remodeling of synapses during plasticity.

    • UNC-9-mediated coupling might coordinate the activity of neuronal ensembles during learning.

  • Research approaches to explore this question:

    • Examine how UNC-9 function changes in response to learning paradigms in C. elegans.

    • Use cell-specific and temporally controlled manipulation of UNC-9 to determine its role in established learning tasks.

    • Investigate whether UNC-9 is regulated by neuronal activity or neuromodulators associated with learning.

This represents an exciting frontier for future research, as understanding the role of electrical synapses in learning could complement the extensive knowledge of chemical synaptic plasticity.

How can UNC-9 research inform therapeutic approaches for neurological disorders?

UNC-9 research has potential applications for understanding and treating neurological disorders:

  • Relevance to human disease:

    • Gap junction dysfunction has been implicated in several neurological disorders, including epilepsy, stroke, and neurodegenerative diseases.

    • Understanding the basic biology of innexins like UNC-9 can provide insights into how related proteins function in the human brain.

    • The discovery of channel-independent functions of UNC-9 suggests that gap junction proteins might contribute to neurological disorders through multiple mechanisms .

  • Therapeutic implications:

    • Targeted modulation of gap junction function could represent a novel approach for treating conditions characterized by abnormal neural synchrony.

    • Small molecules that selectively modify gap junction properties might have therapeutic potential.

    • Gene therapy approaches targeting the human homologs of UNC-9 could potentially address certain gap junction-related disorders.

  • Experimental models and translational approaches:

    • C. elegans models expressing human disease-associated variants of gap junction proteins could serve as platforms for drug screening.

    • The genetic tools developed for UNC-9 research (such as dominant-negative constructs) could be adapted for use in mammalian systems .

    • High-throughput screening approaches in C. elegans could identify compounds that modulate gap junction function for potential therapeutic development.

Research institutions like UNC-Chapel Hill have significant capacity for translational research in this area, with over $907 million in annual research funding and ranking as the 9th largest US research university in research volume and expenditures .

What are the best experimental systems for recombinant UNC-9 expression and purification?

For recombinant UNC-9 expression and purification, consider these systems and approaches:

  • Expression systems:

    • Bacterial systems (E. coli): Suitable for producing soluble domains of UNC-9, but full-length membrane proteins are challenging. Consider using specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression.

    • Yeast systems (P. pastoris): Offer eukaryotic processing with high yield for membrane proteins. The methylotrophic yeast P. pastoris has been successful for other channel proteins.

    • Insect cell systems (Sf9, High Five): Provide more complex post-translational modifications and better folding of multi-spanning membrane proteins like UNC-9.

    • Mammalian cell systems (HEK293, CHO): Offer the most native-like processing but at lower yields. Consider tetracycline-inducible systems for controlled expression.

  • Purification strategies:

    • Use affinity tags (His6, FLAG, or Strep-tag II) positioned at termini least likely to interfere with function.

    • For maintaining protein stability, extract with mild detergents (DDM, LMNG, or GDN).

    • Consider nanodiscs or styrene maleic acid lipid particles (SMALPs) to maintain the native lipid environment.

    • Implement size exclusion chromatography as a final purification step to ensure homogeneity.

  • Functional validation:

    • Confirm protein folding by circular dichroism spectroscopy.

    • Verify channel formation in lipid bilayer systems or through reconstitution into liposomes.

    • For channel-independent functions, develop binding assays with potential interacting partners.

Tagging strategies should be chosen carefully, as the N-terminal region of UNC-9 is critical for channel function but not for its channel-independent role in synaptic tiling .

What advanced imaging techniques can reveal UNC-9 dynamics and interactions?

Advanced imaging techniques to study UNC-9 dynamics and interactions include:

  • Super-resolution microscopy:

    • STORM/PALM: Achieve 10-20nm resolution to visualize individual UNC-9 channels and their organization at gap junctions.

    • STED microscopy: Examine the nanoscale architecture of UNC-9-containing gap junctions in live or fixed samples.

    • Expansion microscopy: Physically expand samples to resolve UNC-9 distribution at conventional microscope resolution.

  • Protein interaction and dynamics:

    • FRET/FLIM: Measure direct interactions between UNC-9 and other proteins with nanometer precision.

    • BiFC (Bimolecular Fluorescence Complementation): Visualize protein interactions by reconstituting a fluorescent protein when two tagged proteins interact.

    • Single-particle tracking: Follow individual UNC-9 molecules to understand their movement and clustering dynamics.

    • Optogenetic approaches: Use light-sensitive protein interactions to manipulate UNC-9 clustering or function with spatial and temporal precision.

  • Functional imaging:

    • Voltage imaging: Directly visualize electrical coupling through UNC-9 gap junctions using genetically encoded voltage indicators.

    • Calcium imaging: Monitor activity propagation through UNC-9-coupled networks.

    • Correlative light-electron microscopy: Relate the molecular organization of UNC-9 to the ultrastructural features of gap junctions.

  • In vivo applications:

    • Light-sheet microscopy: Capture UNC-9 dynamics across entire neuronal networks in living organisms.

    • Two-photon microscopy: Image UNC-9 in deeper tissues with reduced phototoxicity.

    • Intravital microscopy: Study UNC-9 in its native context with minimal disruption.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.