Recombinant Intracellular septation protein (yciB)

Shipped with Ice Packs
In Stock

Description

Structure and Functional Domains

yciB is a 179-amino acid protein with five transmembrane domains and a cytoplasmic C-terminus. Its topology positions it to interact with cytoplasmic and periplasmic components. Key features include:

  • Transmembrane domains: Span the inner membrane, enabling interactions with cytoplasmic and periplasmic proteins .

  • C-terminal region: Mediates toxicity when overexpressed, as truncation of the last 9 residues reduces toxicity .

Cell Division and Septation

yciB interacts with proteins involved in cell division (e.g., ZipA, ZapA) and elongation (e.g., RodZ, MreB) via bacterial two-hybrid assays . It stabilizes the localization of septation machinery but does not localize to the division septum itself .

Membrane Integrity

ΔyciB mutants exhibit hypersensitivity to low osmolarity and detergents, indicating compromised envelope stability . Overexpression elongates cells, suggesting a regulatory role in cell shape .

Synthetic Lethality with dcrB

Deletion of yciB and dcrB (encoding a lipoprotein) is lethal due to mislocalization of outer membrane (OM) lipoproteins (e.g., Lpp) to the inner membrane (IM), triggering toxic peptidoglycan-IM linkages .

Protein Interactions and Pathways

yciB interacts with diverse proteins critical for cell envelope biogenesis and stress responses (Table 1).

Interacting ProteinFunctionInteraction StrengthSource
yciCInner membrane protein0.973 (high)
yciAAcyl-CoA esterase0.859
ZipAFtsZ stabilizerBacterial two-hybrid
RodZMorphogenetic proteinGenetic interaction
dcrBLipoprotein (synthetic lethal partner)Genetic screen
  • Structural studies: Elucidate membrane topology and interaction surfaces .

  • Biochemical assays: Investigate lipoprotein maturation defects in yciB dcrB mutants .

  • Stress response analysis: Monitor Rcs and Cpx signaling activation .

Lipoprotein Maturation Defects

In yciB dcrB mutants, lipoproteins (e.g., Lpp) accumulate in immature forms at the IM, disrupting OM biogenesis. This triggers Rcs and Cpx stress responses, leading to cell death .

Osmotic Stress Sensitivity

ΔyciB mutants show reduced viability in low-osmolarity media, correlating with compromised cell wall integrity .

Genetic Interactions

Overexpression of yciB suppresses the spherical morphology of rodZ mutants, highlighting its role in morphogenetic regulation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize developing it for you.
Synonyms
yciB; ispA; SF1257; S1343; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Shigella flexneri
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVV FGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLSKELTLPQPVWSKLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis. It is essential for normal cell division and is involved in virulence through intercellular spreading.
Database Links

KEGG: sfl:SF1257

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the membrane topology of YciB in Escherichia coli?

YciB is a polytopic inner membrane protein in Escherichia coli containing five transmembrane domains. The membrane topology has been experimentally confirmed using a dual pho-lac reporter system, validating computational predictions of its structure. This experimental approach determines whether protein segments reside in the cytoplasm or periplasm by measuring differential reporter activity in bacterial colonies on indicator plates.

What is the primary cellular role of YciB?

YciB functions in the synthesis of the bacterial cell envelope by interacting with both cell elongation and cell division complexes. Research has demonstrated that YciB deletion mutants exhibit increased susceptibility to low osmolarity environments, suggesting its involvement in maintaining cell envelope integrity under osmotic stress conditions. Additionally, YciB has been implicated in normal biofilm formation processes and interacts genetically with rodZ, a gene essential for maintaining proper rod-type bacterial morphology.

How is YciB involved in bacterial cell division?

YciB interacts with various proteins involved in both cell elongation and cell division processes. These interactions have been experimentally verified using bacterial two-hybrid systems. The protein appears to function as part of the cell envelope synthesis machinery, potentially serving as a scaffold or regulator for proper assembly of protein complexes involved in peptidoglycan synthesis during both cell elongation and division phases.

What proteins interact with YciB and what cellular complexes does it participate in?

YciB has been demonstrated to interact with components of both the elongasome and divisome complexes in bacteria. Using bacterial two-hybrid analysis, researchers have identified interactions between YciB and proteins involved in cell elongation (including RodZ) and cell division. These interaction networks suggest YciB plays a coordinating role between these two critical cellular processes by potentially facilitating communication between the elongation and division machineries.

What is the relationship between YciB and DcrB in maintaining cell envelope integrity?

Research has revealed a synthetic lethal relationship between yciB and dcrB (an inner membrane lipoprotein gene) when cells are grown in low-salt medium. This synthetic lethality stems from the mislocalization of the major outer membrane lipoprotein Lpp to the inner membrane in the double mutant, resulting in abnormal and toxic peptidoglycan-inner membrane linkages. This relationship highlights the complementary functions of YciB and DcrB in maintaining proper cell envelope organization and integrity.

How does the absence of YciB affect lipoprotein processing and localization?

In the absence of both YciB and DcrB, the cell experiences defects in the first step of lipoprotein maturation. The phosphatidylglycerol:preprolipoprotein diacylglyceryl transferase (Lgt), which catalyzes the initial step in lipoprotein maturation, exhibits attenuated function. This inefficient lipid modification results in the mislocalization of the abundant outer membrane lipoprotein Lpp to the inner membrane, where it forms toxic linkages to peptidoglycan. The mechanism may involve altered membrane fluidity affecting Lgt function rather than reduced phosphatidylglycerol levels.

What techniques are effective for determining YciB membrane topology?

The dual pho-lac reporter system has proven effective for experimental verification of YciB membrane topology. This technique involves creating fusion proteins containing the C-terminus of YciB attached to a dual reporter (alkaline phosphatase and β-galactosidase). The differential activity of these enzymes in either the cytoplasm or periplasm produces distinct color changes on indicator plates, allowing researchers to map the orientation of transmembrane domains. For more detailed analysis, cysteine scanning mutagenesis coupled with accessibility studies using membrane-impermeable thiol-reactive reagents can provide additional topology information.

How can protein-protein interactions of YciB be effectively studied?

Bacterial two-hybrid (B2H) systems have been successfully employed to identify protein interaction partners of YciB. This methodology involves:

  • Creating fusion constructs of YciB with one domain of a split transcription factor

  • Creating similar fusions with potential interacting partners

  • Co-expressing these constructs in reporter strains

  • Measuring reporter gene activation as an indicator of protein interaction

Site-directed mutagenesis approaches have been useful for mapping specific interaction interfaces. By systematically mutating conserved residues and testing the effects on known interactions, researchers have identified key regions involved in specific protein-protein interactions, particularly in the transmembrane domain (v1 region) and a conserved region including residues H76-F95 (v5 region).

What are the recommended approaches for generating and characterizing yciB deletion mutants?

When generating yciB deletion mutants, researchers should consider the following methodological approaches:

  • Use lambda Red recombineering or CRISPR-Cas9 systems for precise gene deletion

  • Confirm deletions by PCR and sequencing

  • Conduct complementation studies with plasmid-expressed wild-type YciB

  • Test growth in varying osmolarity conditions, as yciB mutants show specific susceptibility to low osmolarity

  • Examine cell morphology using phase contrast and electron microscopy

  • Assess envelope integrity using detergent and antibiotic sensitivity assays

  • Analyze biofilm formation capacity using crystal violet staining methods

When working with yciB dcrB double mutants, special consideration must be given to growth medium composition, particularly salt concentration, due to the synthetic lethality observed in low-salt conditions.

How should researchers interpret phenotypic differences between single and double deletion mutants involving yciB?

When interpreting phenotypic differences between single yciB mutants and double mutants (particularly yciB dcrB), researchers should consider functional redundancy and pathway compensation. The synthetic lethality observed in yciB dcrB double mutants indicates that these proteins have partially overlapping functions in maintaining cell envelope integrity.

The interpretation should include analysis of:

  • Growth curves under various conditions (temperature, osmolarity)

  • Cell morphology changes using microscopy

  • Envelope stress response activation (Cpx, Rcs, σE pathways)

  • Lipoprotein processing and localization

  • Peptidoglycan crosslinking patterns

A key insight from existing research is that yciB single mutants may show mild phenotypes due to compensation by DcrB, while the double mutant reveals the critical nature of their combined function in lipoprotein processing.

What controls should be included when analyzing YciB protein interactions?

When analyzing YciB protein interactions, the following controls should be included:

  • Empty vector controls to assess background signal in interaction assays

  • Known non-interacting protein pairs as negative controls

  • Known interacting protein pairs as positive controls

  • Truncated YciB variants lacking transmembrane domains to assess membrane dependency of interactions

  • YciB variants with systematic mutations in conserved regions to map interaction interfaces

  • Reciprocal tagging configurations (e.g., testing both bait-prey and prey-bait configurations)

Research has demonstrated that the transmembrane region of YciB is particularly important for protein interactions, as deletion of this region (as in variant v7) abolishes all known interactions, suggesting proper membrane localization is critical for YciB function.

How can researchers distinguish between direct and indirect effects when studying YciB function?

Distinguishing between direct and indirect effects in YciB functional studies requires multiple complementary approaches:

  • In vitro reconstitution: Purify YciB and potential interacting partners to test direct interactions in membrane mimetics

  • Domain mapping: Use site-directed mutagenesis to identify specific residues required for each function

  • Temporal analysis: Employ time-course experiments to establish the sequence of cellular events after YciB perturbation

  • Suppressor screening: Identify genetic suppressors that rescue yciB mutant phenotypes to map genetic pathways

  • Condition-specific phenotyping: Test mutant phenotypes under various stress conditions to identify specific functional contexts

For example, research has shown that skp deletion suppresses yciB dcrB synthetic lethality indirectly through the σE-MicL-Lpp regulatory pathway rather than through direct interaction, demonstrating the importance of pathway analysis in interpreting genetic interactions.

What are the implications of YciB research for understanding bacterial cell envelope biogenesis?

YciB research provides critical insights into bacterial cell envelope biogenesis by:

  • Revealing coordination mechanisms between cell elongation and division processes

  • Identifying key proteins involved in maintaining envelope integrity under varying environmental conditions

  • Elucidating lipoprotein processing and trafficking pathways

  • Uncovering stress response mechanisms activated by envelope perturbations

  • Demonstrating functional redundancy among inner membrane proteins

The synthetic lethality between yciB and dcrB particularly highlights redundant mechanisms that ensure robust envelope assembly, with their combined absence resulting in defective lipoprotein processing and toxic mislocalization of Lpp. This research contributes to our fundamental understanding of how bacteria maintain envelope integrity while coordinating growth and division.

How does understanding YciB function contribute to antimicrobial research?

Understanding YciB function can contribute to antimicrobial research in several ways:

  • Novel target identification: As an inner membrane protein involved in envelope synthesis, YciB or its interaction partners may represent new antibiotic targets

  • Combination therapy approaches: The synthetic lethality with dcrB suggests potential for combination therapies targeting redundant envelope maintenance pathways

  • Stress response modulation: Insights into how YciB deletion activates envelope stress responses may reveal approaches to sensitize bacteria to existing antibiotics

  • Peptidoglycan-membrane interface targeting: The role of YciB in coordinating envelope components highlights the peptidoglycan-membrane interface as a vulnerable target

Researchers found that yciB dcrB mutants exhibit increased susceptibility to cell wall-targeting antibiotics, suggesting that inhibiting YciB function could potentially sensitize bacteria to existing antimicrobial compounds.

What research questions about YciB remain unanswered and what techniques might address them?

Several important questions about YciB remain unanswered:

  • Precise biochemical function: The exact enzymatic or structural role of YciB remains unclear. Approaches like in vitro reconstitution of YciB with potential substrates and interaction partners in liposomes could elucidate its biochemical function.

  • Structural details: While the membrane topology is known, high-resolution structural information is lacking. Cryo-electron microscopy of YciB in membrane environments or X-ray crystallography of stabilized YciB complexes could provide detailed structural insights.

  • Regulatory mechanisms: How YciB activity is regulated during the cell cycle remains unknown. Phosphoproteomic analysis of YciB under different growth conditions might reveal regulatory post-translational modifications.

  • Coordination with divisome assembly: The precise timing and mechanism of YciB's interaction with divisome components need further investigation. Fluorescence microscopy with tagged YciB variants combined with super-resolution techniques could track YciB localization during cell division.

  • Conservation across bacterial species: While YciB homologs exist across bacterial species, their functional conservation requires experimental verification. Complementation studies with heterologous YciB proteins could address functional conservation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.