Recombinant Invertebrate iridescent virus 3 Probable cysteine proteinase 024R (IIV3-024R)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Invertebrate iridescent virus 3 Probable cysteine proteinase 024R (IIV3-024R) is a protein encoded by the Invertebrate iridescent virus 3 (IIV-3), also known as mosquito iridescent virus, which is currently the sole member of the genus Chloriridovirus . Iridoviruses (IVs) are classified into five genera: Iridovirus and Chloriridovirus, whose members infect invertebrates, and Ranavirus, Lymphocystivirus, and Megalocytivirus, whose members infect vertebrates .

Genomic Context

IIV-3 possesses a genome of approximately 190 kbp, with a G+C content of 48% . The genome contains 126 predicted open reading frames (ORFs) . Among these ORFs, IIV3-024R is annotated as a probable cysteine proteinase . Cysteine proteinases are enzymes that utilize a cysteine residue in their active site to catalyze the hydrolysis of peptide bonds .

Characteristics of IIV-3

IIV-3 is unique, with 33 unique genes, 27 homologues of genes present in all sequenced IVs, and 52 genes present in IIV-6 but not in VIVs . The IIV-3 genome does not exhibit colinearity with any other completely sequenced IV genome .

Role of Cysteine Proteinase

The IIV3-024R gene product is annotated as a probable cysteine proteinase, suggesting its involvement in proteolytic processes during the viral life cycle . Cysteine proteinases are known to play crucial roles in various viral processes, including viral entry, replication, assembly, and egress . Further research would be needed to elucidate the precise function of IIV3-024R in IIV-3 infection.

Significance

FeatureDescription
Virus TypeInvertebrate iridescent virus 3 (IIV-3)
Protein TypeProbable cysteine proteinase
Genome SizeApproximately 190 kbp
G+C Content48%
Number of Open Reading Frames126
FunctionThe IIV3-024R gene product is annotated as a probable cysteine proteinase, suggesting its involvement in proteolytic processes during the viral life cycle . Cysteine proteinases are known to play crucial roles in various viral processes, including viral entry, replication, assembly, and egress . Further research would be needed to elucidate the precise function of IIV3-024R in IIV-3 infection.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
IIV3-024R; Probable cysteine proteinase 024R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-491
Protein Length
full length protein
Species
Invertebrate iridescent virus 3 (IIV-3) (Mosquito iridescent virus)
Target Names
IIV3-024R
Target Protein Sequence
MTLEWNIDDKFHLFFRKKRSVYIVGGVHHDEDEVDPKVVAQSGLQGDDGVVRLPPLNTLV NFLGHVSPYMHADYAFLHREWEYNRTASFADDLVNLPSVYDWRYVYPRDDEETKRKKRYI MPPDNQYLCGSCWAVSTASAIGDAYVVAGLVDWRPDISPAWALTCYPQGQCEGGSPALLL KEISQGNGIVSNHCLDYSFCASNPRCNGAAANHFGAENLSELVPKSCGCYVGDSMHYRYT VDPLIRTLAIGVGTVTEENIQSTIKRHILTHGPVLAGYFVLKNFTSGYFTRINGGVYFDR GNYIPGQALVFNDHYCSGDSYRGSHAVAIIGWGVARNVLYDTDKRGDVPYWYCRNSWRST WGGDDGYFKMAMYPWNRVAQFEKLVTLRDRDNVPHRCGGIITFTVSTKPVKVKMNQLNTT LLPFPLLRDRSWYGGDQEEYRPAIVPKLAPSDGPNKPPLPLPVYYSALDLALLVLPALLI VIVVLIGKIPT
Uniprot No.

Target Background

Function
Probable cysteine protease.
Database Links

KEGG: vg:4156274

Protein Families
Peptidase C1 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the fundamental structure and function of IIV3-024R protein?

IIV3-024R is a full-length (1-491 amino acids) probable cysteine proteinase encoded by the Invertebrate Iridescent Virus 3, also known as Mosquito Iridescent Virus. As a viral cysteine proteinase, it likely plays critical roles in viral replication, protein processing, and host-pathogen interactions. The protein has been successfully expressed in E. coli systems with His-tagging for research purposes . When designing experiments with this protein, researchers should consider its enzymatic nature and potential catalytic domains. Functional characterization should include protease activity assays under various pH and temperature conditions to establish optimal experimental parameters.

How can I confirm the purity and integrity of recombinant IIV3-024R preparation?

Recombinant IIV3-024R purity assessment should follow a multi-method approach. Begin with SDS-PAGE analysis to confirm molecular weight (expected around 55-60 kDa including the His-tag). Follow with Western blotting using anti-His antibodies to verify the tag's presence. For higher resolution characterization, employ mass spectrometry to confirm protein identity and detect potential post-translational modifications or truncations. Enzymatic activity testing using standard cysteine protease substrates will confirm functional integrity. When interpreting purity data, consider using statistical analysis methods such as ANOVA to compare batch-to-batch variation . Keep detailed records of purification protocols as this data will be essential for troubleshooting and experimental reproducibility.

What are the key variables to control when designing experiments with IIV3-024R?

When designing experiments with IIV3-024R, you must systematically identify and control variables that might influence your results. Key independent variables include protein concentration, buffer composition, pH, temperature, and substrate specificity. Dependent variables typically include enzymatic activity, binding affinity, or cellular effects. Potential confounding variables include batch-to-batch protein variation, storage conditions, and the presence of contaminating proteases .

For rigorous experimental design:

  • Create a detailed variable matrix:

Variable TypeExamples for IIV3-024R ResearchControl Method
IndependentProtein concentration, pH, temperaturePrecise measurement, calibrated instruments
DependentEnzymatic activity, substrate cleavageStandardized assays, multiple replicates
ExtraneousBuffer composition, salt concentrationConsistent preparation protocols
ConfoundingProtein stability over timeTime-series measurements, fresh preparations
  • Implement both positive controls (known cysteine proteases) and negative controls (heat-inactivated enzyme) in every experimental set.

  • Consider between-subjects design for comparing different treatment conditions or within-subjects design for time-course experiments .

How should I approach designing inhibition studies for IIV3-024R?

For inhibition studies, employ a systematic approach beginning with a hypothesis about the protease's active site. First, screen broad-spectrum cysteine protease inhibitors (e.g., E-64, leupeptin) to confirm the enzyme class. Then progress to more selective inhibitors to characterize the active site. Design a dose-response experimental matrix testing at least 5-7 concentrations of each inhibitor spanning 3 orders of magnitude around the predicted IC50 .

For statistical validity:

  • Use at least triplicate measurements for each inhibitor concentration

  • Include appropriate controls: no-inhibitor (100% activity) and no-enzyme (0% activity)

  • Apply non-linear regression analysis to calculate IC50 values

  • Consider enzyme kinetics models (competitive, non-competitive, uncompetitive) to determine inhibition mechanisms

When analyzing inhibition data, use diagnostic statistical methods to validate your models and identify potential outliers . Present your findings as IC50 values with confidence intervals rather than single data points.

What are the optimal approaches for studying IIV3-024R interaction with host proteins?

Studying IIV3-024R interactions with host proteins requires multiple complementary approaches. Begin with in silico prediction of potential interaction partners based on homology to known cysteine proteases. Then validate these predictions experimentally using:

  • Pull-down assays: Use His-tagged IIV3-024R as bait to isolate interacting proteins from host cell lysates, followed by mass spectrometry identification .

  • Yeast two-hybrid screening: Create a bait construct with IIV3-024R and screen against a cDNA library derived from susceptible host cells.

  • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI): For quantitative binding kinetics of identified interactions.

  • Co-immunoprecipitation from infected cells: To confirm interactions under physiological conditions.

Data from these experiments should be analyzed using appropriate statistical methods to distinguish genuine interactions from background. Consider employing both descriptive analysis (to characterize the interaction networks) and diagnostic analysis (to understand the functional significance of specific interactions) . Remember that protein-protein interactions often depend on post-translational modifications, so experimental conditions should mimic the viral infection environment as closely as possible.

How can I develop a robust experimental system to study IIV3-024R's role in viral replication?

Developing a system to study IIV3-024R's role in viral replication requires a multi-step approach combining molecular virology and protease biochemistry. First, establish if IIV3-024R is essential for viral replication through gene knockout or silencing studies. This requires:

  • Creating a reverse genetics system for IIV3 (if not already available)

  • Developing mutant viruses with inactive IIV3-024R (e.g., active site mutations)

  • Establishing quantitative assays to measure viral replication kinetics

When designing these experiments, carefully define your variables: the independent variable is the IIV3-024R status (wild-type, mutant, or absent), while dependent variables include viral titer, cytopathic effects, and viral protein processing .

Complement genetic approaches with biochemical studies using recombinant IIV3-024R to identify viral substrate proteins. Apply statistical methods such as ANOVA to analyze replication kinetics data, and consider using predictive analysis techniques to model how protease inhibition affects the viral life cycle . This combined approach will provide mechanistic insights into IIV3-024R function during infection.

What statistical approaches are most appropriate for analyzing enzymatic activity data for IIV3-024R?

When analyzing enzymatic activity data for IIV3-024R, select statistical methods based on your experimental design and data characteristics. For basic kinetic parameters (Km, Vmax), non-linear regression analysis using enzyme kinetics models is most appropriate. When comparing activity across different conditions (pH, temperature, inhibitors), consider these approaches:

  • For normally distributed data: Use parametric tests like t-tests (for two conditions) or ANOVA (for multiple conditions), followed by post-hoc tests (e.g., Tukey's) to identify specific differences between groups .

  • For non-normally distributed data: Apply non-parametric alternatives such as Mann-Whitney U or Kruskal-Wallis tests.

  • For time-course experiments: Consider repeated measures ANOVA or mixed-effects models.

Always begin with descriptive statistics to understand data distribution and identify potential outliers. Report not just p-values but also effect sizes and confidence intervals. For complex datasets with multiple variables, consider multivariate approaches like principal component analysis to identify patterns. Apply diagnostic analysis to understand factors influencing enzymatic activity, and when appropriate, use predictive models to forecast activity under untested conditions .

How should I approach data contradictions in IIV3-024R research?

When facing contradictory results in IIV3-024R research, apply a systematic troubleshooting approach rather than discarding data. First, conduct a detailed diagnostic analysis to identify potential sources of variation :

  • Experimental conditions: Check for differences in buffer composition, pH, temperature, and protein batch.

  • Methodological differences: Compare assay principles, detection methods, and data analysis approaches.

  • Biological factors: Consider protein isoforms, post-translational modifications, or host cell differences.

Create a comparison table documenting all experimental variables across contradictory results:

VariableExperiment 1Experiment 2Potential Impact
Protein sourceE. coliBaculovirusFolding, PTMs
BufferPhosphate, pH 7.0Tris, pH 8.0Enzymatic activity
Temperature25°C37°CReaction kinetics
Detection methodFluorescenceAbsorbanceSensitivity, specificity

Design validation experiments specifically targeting the identified differences. Apply statistical methods appropriate for your experimental design to determine if observed contradictions are statistically significant or within expected experimental variation . Remember that contradictions often lead to new discoveries about regulatory mechanisms or context-dependent protein functions.

What are the best approaches to troubleshoot low activity or instability of recombinant IIV3-024R?

When encountering low activity or instability of recombinant IIV3-024R, implement a systematic troubleshooting approach focusing on protein expression, purification, and storage conditions. Begin by examining expression systems - E. coli-expressed IIV3-024R may lack essential post-translational modifications or proper folding . Consider these methodological interventions:

  • Expression system optimization:

    • Test alternative expression vectors with different promoters

    • Explore eukaryotic expression systems (insect cells, yeast)

    • Optimize induction conditions (temperature, duration, inducer concentration)

  • Purification refinement:

    • Implement multi-step purification to improve purity

    • Test different buffer compositions (pH, salt concentration, reducing agents)

    • Add protease inhibitors to prevent auto-degradation

  • Stability enhancement:

    • Screen various buffer additives (glycerol, arginine, trehalose)

    • Determine thermal stability using differential scanning fluorimetry

    • Assess time-dependent activity loss under different storage conditions

For each intervention, measure activity using standardized assays and apply statistical analysis to determine significant improvements . Document all modifications to protocols and their effects on protein yield, purity, and activity to build a comprehensive understanding of the factors affecting IIV3-024R functionality.

How can I optimize experimental design to study IIV3-024R substrate specificity?

Optimizing experimental design for IIV3-024R substrate specificity studies requires a multi-faceted approach combining biochemical assays, bioinformatics, and structural analysis. Begin with a hypothesis about potential substrates based on homology to related viral proteases. Then:

  • Develop a diverse substrate library:

    • Synthetic peptides with systematic amino acid substitutions around the predicted cleavage site

    • Fluorogenic substrates for quantitative activity measurements

    • Potential natural substrates from both viral and host proteomes

  • Implement a structured experimental design:

    • Test each substrate under identical conditions

    • Include positive controls (known substrates of related proteases)

    • Measure kinetic parameters (kcat, Km) for each substrate

  • Apply advanced analysis techniques:

    • Develop a position-specific scoring matrix for preferred residues

    • Use machine learning algorithms to identify patterns in substrate preference

    • Correlate experimental data with structural models of the enzyme-substrate complex

This comprehensive approach allows for both descriptive analysis (characterizing the substrate preference) and predictive analysis (identifying new potential substrates) . Statistically analyze results using ANOVA to compare cleavage efficiency across substrates, and apply multiple regression techniques to identify the contribution of individual amino acid positions to substrate recognition .

What experimental designs are most effective for studying the potential role of IIV3-024R in host immune evasion?

To investigate IIV3-024R's potential role in host immune evasion, design experiments that examine interactions with host immune pathways. Begin with a clear hypothesis based on known mechanisms of viral cysteine proteases, such as cleavage of immune signaling molecules or cytokines. Implement these experimental approaches:

  • Comparative proteomics:

    • Compare protein profiles of mock-infected versus infected cells, with or without protease inhibitors

    • Use stable isotope labeling (SILAC) for quantitative comparison

    • Focus analysis on immune-related proteins showing altered processing patterns

  • Targeted immune pathway analysis:

    • Examine NF-κB, JAK-STAT, and interferon signaling pathways

    • Test each pathway component as potential IIV3-024R substrate

    • Measure pathway activation with and without active IIV3-024R

  • In vivo immune response studies:

    • Compare immune responses to wild-type versus protease-deficient viruses

    • Measure cytokine profiles, immune cell recruitment, and viral clearance

Apply appropriate statistical methods to analyze complex datasets, including ANOVA for comparing treatment groups and regression analysis for identifying correlations between protease activity and immune suppression . Use both descriptive analysis to characterize immune evasion mechanisms and predictive analysis to forecast the impact of potential inhibitors on viral pathogenesis .

How should researchers approach integrating structural biology with functional studies of IIV3-024R?

Integrating structural biology with functional studies requires a carefully designed research pipeline that allows structural insights to inform functional experiments and vice versa. Begin by generating a high-quality structural model of IIV3-024R through X-ray crystallography, cryo-EM, or homology modeling based on related cysteine proteases. Then implement this integration strategy:

  • Structure-guided mutagenesis:

    • Identify catalytic residues and substrate-binding pockets

    • Create point mutations at key structural features

    • Test mutant proteins for altered activity, specificity, or stability

  • Structure-based inhibitor design:

    • Use the active site structure to design potential inhibitors

    • Dock candidate molecules in silico before experimental testing

    • Validate binding modes through co-crystallization studies

  • Conformational dynamics analysis:

    • Apply molecular dynamics simulations to predict functional states

    • Validate predictions through techniques like hydrogen-deuterium exchange

    • Correlate conformational changes with enzymatic activity

Data analysis should combine structural parameters with functional readouts, using correlation analysis and multivariate statistical methods to identify structure-function relationships . This integrated approach provides much deeper insights than either structural or functional studies alone, enabling both diagnostic analysis of mechanism and predictive analysis for rational design of inhibitors or activity modulators .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.