Recombinant Invertebrate iridescent virus 3 Putative FAD-linked sulfhydryl oxidase 096R (IIV3-096R)

Shipped with Ice Packs
In Stock

Description

Introduction to IIV3-096R

The recombinant IIV3-096R protein is a full-length, His-tagged version of the 096R gene product from Invertebrate iridescent virus 3 (IIV-3), a member of the family Iridoviridae. This protein is annotated as a putative FAD-linked sulfhydryl oxidase, suggesting a potential role in redox reactions involving thiol groups.

3.1. Putative Enzymatic Activity

IIV3-096R is predicted to catalyze sulfhydryl oxidation via FAD, a cofactor critical for electron transfer reactions. This activity may support viral replication or stress response pathways, though experimental validation remains pending.

3.2. Viral Genome Context

IIV3-096R is part of the IIV-3 genome, which shares structural and genetic similarities with other iridoviruses like IIV-6 and IIV-9 . While IIV3-096R’s exact role in the viral life cycle is unclear, its expression in E. coli facilitates functional studies.

4.1. Experimental Uses

  • Enzyme Activity Assays: Testing FAD-dependent sulfhydryl oxidation using in vitro substrates.

  • Viral Replication Studies: Investigating interactions with IIV-3 proteins or host factors.

  • Structural Biology: Crystallization for X-ray diffraction or cryo-EM studies.

Key Research Gaps

  1. Functional Validation: No published studies confirm sulfhydryl oxidase activity.

  2. Interactome Data: Protein-protein interactions within IIV-3 or host cells remain uncharacterized.

  3. Evolutionary Context: Comparative analysis with homologs in other iridoviruses (e.g., IIV-6) is needed .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
IIV3-096R; Putative FAD-linked sulfhydryl oxidase 096R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Invertebrate iridescent virus 3 (IIV-3) (Mosquito iridescent virus)
Target Names
IIV3-096R
Target Protein Sequence
MSIDPKLWGNAFWSTLHHVAAGYNDHPSLGARQVMTNFIQSIPVLLPCAECQDHAFDYIG RADLDRVVSSRRQLFLFFFNFHNHVNARLNKPQLAAKTVFQRYRVPFDGEAAAATTEPPF HWSPWLTTALAVILVVVVAGIGHRSRFK
Uniprot No.

Target Background

Function
FAD-dependent sulfhydryl oxidase that catalyzes disulfide bond formation.
Database Links

KEGG: vg:4156240

Protein Families
IIV-6 347L family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is IIV3-096R and how is it classified within the IIV-3 genome?

IIV3-096R is a predicted gene product from the Invertebrate Iridescent Virus type 3 (IIV-3) genome, classified as a putative FAD-linked sulfhydryl oxidase. IIV-3, also known as mosquito iridescent virus, is currently the sole member of the Chloriridovirus genus within the Iridoviridae family . The IIV-3 genome consists of approximately 190 kbp with 126 predicted genes, of which 096R appears to encode a protein with sulfhydryl oxidase activity .

Methodologically, researchers should approach classification studies by:

  • Performing comparative genomic analysis against other iridoviruses

  • Utilizing phylogenetic approaches to determine evolutionary relationships

  • Employing structural prediction software to identify conserved domains

  • Conducting transcriptomic analysis to verify expression patterns during infection

How does the structure of IIV3-096R compare to other known FAD-linked sulfhydryl oxidases?

The putative structure of IIV3-096R likely follows the general architecture of FAD-dependent sulfhydryl oxidases, with the FAD prosthetic group housed at the mouth of a 4-helix bundle that communicates with a pair of juxtaposed cysteine residues forming the proximal redox active disulfide . Unlike some eukaryotic sulfhydryl oxidases that contain additional domains, viral sulfhydryl oxidases typically maintain a more streamlined structure.

Comparative structural analysis should include:

  • Homology modeling based on crystal structures of related proteins

  • Identification of conserved redox-active cysteine residues

  • Mapping of FAD binding residues

  • Prediction of substrate interaction sites through molecular docking

What are the established protocols for recombinant expression of IIV3-096R?

For optimal recombinant expression of IIV3-096R, researchers should consider a workflow similar to that used for other viral sulfhydryl oxidases:

  • Clone the coding sequence into an expression vector with an N-terminal His-tag

  • Transform into a suitable E. coli strain (BL21 derivatives are commonly used)

  • Grow cultures at 37°C until reaching OD600 of 0.5-0.8

  • Induce with IPTG (0.1-0.5 mM) and reduce temperature to 16-25°C

  • Express for 16-24 hours

  • Harvest cells by centrifugation at 6000g for 30 minutes

  • Lyse cells using French press or sonication

  • Purify using nickel-affinity chromatography

  • Ensure maximum FAD content by incubating with a two-fold excess of FAD

  • Perform final purification by gel filtration

Protein yield and purity should be assessed by SDS-PAGE, and FAD incorporation can be verified by measuring the A280/A450 absorbance ratio.

What are the redox characteristics and enzymatic properties of IIV3-096R?

The redox behavior of IIV3-096R likely shares similarities with other FAD-dependent sulfhydryl oxidases, catalyzing the following reaction:

R-SH+R’-SH+O2R-S-S-R’+H2O2\text{R-SH} + \text{R'-SH} + \text{O}_2 \rightarrow \text{R-S-S-R'} + \text{H}_2\text{O}_2

Based on studies of similar enzymes, researchers should investigate:

  • Redox potential using dithionite and photochemical reduction methods

  • pH-dependence of enzyme activity (optimal range likely pH 7.0-8.5)

  • Substrate specificity using various dithiol compounds

  • Kinetic parameters including Km, kcat, and catalytic efficiency

  • Inhibition profiles with thiol-reactive compounds

The mid-point potential is likely around -200 mV at pH 7.5, similar to other viral sulfhydryl oxidases . Complete characterization should include determination of the extinction coefficient at 450 nm, which for related enzymes is approximately 11.7 mM^-1cm^-1 .

How does IIV3-096R interact with viral and host proteins during IIV-3 infection?

Understanding the interaction network of IIV3-096R requires multiple complementary approaches:

  • Yeast two-hybrid screening against both viral and host proteomes

  • Co-immunoprecipitation followed by mass spectrometry

  • Proximity labeling approaches (BioID or APEX)

  • Fluorescence resonance energy transfer (FRET) for direct interaction verification

  • Surface plasmon resonance for binding kinetics

Research should focus on potential interactions with:

  • Other viral proteins involved in virion assembly

  • Host PDI (protein disulfide isomerase) family members

  • Components of the host oxidative folding machinery

  • Proteins involved in redox homeostasis

What is the evolutionary relationship between IIV3-096R and sulfhydryl oxidases from other viral families?

The evolutionary history of IIV3-096R can be explored through detailed phylogenetic analysis. IIV-3 is distantly related to other iridovirus genera, showing low levels of amino acid identity in predicted proteins and lack of obvious colinearity with other sequenced iridoviruses .

Research approaches should include:

  • Multiple sequence alignment of sulfhydryl oxidases from diverse viral sources

  • Bayesian and maximum likelihood phylogenetic tree construction

  • Analysis of selection pressures using dN/dS ratios

  • Identification of conserved motifs across viral families

  • Examination of potential horizontal gene transfer events

What are the optimal conditions for measuring IIV3-096R enzymatic activity?

Based on studies of related sulfhydryl oxidases, the following experimental conditions are recommended:

ParameterRecommended ConditionNotes
Buffer system50 mM Tris-HCl or phosphatepH 7.5 optimal
Temperature25°CActivity decreases >37°C
Substrate concentration0.1-10 mM DTT or glutathioneSubstrate inhibition may occur >20 mM
Enzyme concentration0.1-1 μMHigher concentrations may show aggregation
Oxygen availabilityAir-saturated bufferEnsure consistent oxygenation
FAD supplementation2-fold molar excessPre-incubate for complete holoenzyme formation
Ionic strength100-150 mM NaClHigher salt may affect activity
Reducing agentsAvoid during assayWill interfere with oxidase activity

Activity can be monitored through multiple methods:

  • Oxygen consumption using Clark-type electrode

  • H2O2 production using Amplex Red/HRP coupled assay

  • Disulfide bond formation through DTNB reduction

  • Changes in FAD fluorescence during catalytic cycle

How can researchers distinguish between the native and recombinant forms of IIV3-096R in experimental settings?

Distinguishing between native and recombinant IIV3-096R requires careful experimental design:

  • Generate specific antibodies against unique epitopes in IIV3-096R

  • Incorporate differential tags in recombinant proteins (His, FLAG, etc.)

  • Utilize mass spectrometry to identify post-translational modifications present only in native protein

  • Compare enzymatic properties including:

    • Substrate specificity profiles

    • Kinetic parameters

    • Thermal stability

    • pH optima

    • Inhibitor sensitivity

  • Analyze quaternary structure using size exclusion chromatography or analytical ultracentrifugation

Researchers should be aware that recombinant expression may alter folding, disulfide bond formation, and FAD incorporation compared to the native viral environment.

How should researchers address conflicting results in IIV3-096R characterization studies?

When encountering contradictory data regarding IIV3-096R properties, researchers should:

  • Carefully evaluate differences in experimental conditions between studies

  • Consider protein preparation methods, particularly regarding:

    • Expression systems (bacterial vs. insect cells)

    • Purification protocols affecting FAD incorporation

    • Buffer composition affecting redox state

  • Verify protein identity and integrity through:

    • N-terminal sequencing

    • Mass spectrometry

    • Spectral characteristics (A280/A450 ratio)

  • Repeat critical experiments with standardized conditions

  • Perform collaborative cross-laboratory validation studies

  • Consider whether observed differences might represent genuine biological variability

What are the bioinformatic approaches to predict IIV3-096R function based on the IIV-3 genome?

Computational prediction of IIV3-096R function requires integration of multiple bioinformatic approaches:

  • Sequence-based analysis:

    • Hidden Markov Models for domain identification

    • Position-Specific Scoring Matrices for functional motifs

    • Sequence conservation analysis across related viruses

  • Structural prediction:

    • Homology modeling using known sulfhydryl oxidase structures

    • Ab initio modeling of unique regions

    • Molecular dynamics simulations to assess stability

  • Genomic context:

    • Analysis of neighboring genes and potential operonic structures

    • Identification of regulatory elements

    • Comparative genomics across iridovirus genera

  • Transcriptomic integration:

    • Expression timing during infection cycle

    • Co-expression networks with functionally related genes

The IIV-3 genome contains 27 gene homologues present in all sequenced iridoviruses, constituting a genetic core for Iridoviridae . Determining whether IIV3-096R belongs to this core or is Chloriridovirus-specific would provide important functional insights.

What are the emerging techniques that could advance IIV3-096R research?

Several cutting-edge methodologies could significantly enhance our understanding of IIV3-096R:

  • Cryo-electron microscopy for high-resolution structural determination

  • Single-molecule enzymology to capture transient catalytic intermediates

  • Time-resolved X-ray crystallography to visualize the catalytic cycle

  • CRISPR-Cas9 genome editing of IIV-3 to study 096R function in viral context

  • Interactomics using BioID or APEX2 proximity labeling

  • Native mass spectrometry to examine protein complexes

  • Microfluidic approaches for high-throughput enzyme characterization

  • In silico molecular docking for inhibitor design and substrate prediction

  • Multi-omics integration to place 096R in broader infection dynamics

  • Super-resolution microscopy to track 096R localization during infection

These approaches would address fundamental questions about IIV3-096R structure, function, and biological role that remain unanswered with conventional techniques.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.