Recombinant Invertebrate iridescent virus 3 Putative membrane protein 047R (IIV3-047R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Synonyms
IIV3-047R; Putative membrane protein 047R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-407
Protein Length
full length protein
Species
Invertebrate iridescent virus 3 (IIV-3) (Mosquito iridescent virus)
Target Names
IIV3-047R
Target Protein Sequence
MSSIVNGFSIQKSTKTAYDTQQPCDCWDCSAFTAVVGCGQTDGMDDWEFGETACCFTCPN KKQCAKPDPAECNIGTDSHQRDPLTRVTWNGRGPNVQCVYDVNRINTLEQIDNFKQRFGV HGDYNAVVANYCQQSSDSCITDPETGTKMTKCSRFKSDQKDGELCRGWFNQQPKAVQDTV VQNYCAVNNTPDCKCVNRAQNEVYRELKIGKVINDGCWFTPCANPQSYLLTTEVENPTCP SNFCDIIYNIIKDRDVTIDDVKNDINCVFKPDPPPQPKPQPPPDPPKPPPDPPKPDPPPP PPPKPTPPPDPPKPKPDPVPPPKPTPPPPKPTPPPPIPPQPVPILPIPPVDLKKNWIMLT FVGLVLALVIYPKSRHAIGTHTWRNAAIAVLVGLNAFGLQSYVNNHV
Uniprot No.

Target Background

Database Links

KEGG: vg:4156273

Protein Families
IIV-6 337L family
Subcellular Location
Virion membrane; Multi-pass membrane protein.

Q&A

What is IIV3-047R protein and what organism does it originate from?

IIV3-047R is a putative membrane protein encoded by the Invertebrate iridescent virus 3 (IIV-3), also known as Mosquito iridescent virus. This virus belongs to the Iridoviridae family, which consists of large, icosahedral, double-stranded DNA viruses that infect invertebrates and poikilothermic vertebrates. The "047R" designation indicates it is the 47th open reading frame in the viral genome, reading in the rightward direction. As a putative membrane protein, IIV3-047R is thought to be involved in viral membrane structure or function, potentially playing roles in viral entry, assembly, or host-cell interactions .

What are the molecular characteristics of IIV3-047R?

IIV3-047R is a full-length protein consisting of 407 amino acids. The protein contains several hydrophobic regions that are characteristic of membrane proteins. When produced as a recombinant protein with an N-terminal His-tag in E. coli expression systems, the full sequence integrity from amino acid position 1 to 407 is maintained. For research applications, the protein is typically supplied as a lyophilized powder in Tris/PBS-based buffer with 6% Trehalose at pH 8.0. This preparation achieves greater than 90% purity as determined by SDS-PAGE analysis, making it suitable for various experimental applications requiring high-quality protein samples .

How should recombinant IIV3-047R be reconstituted for experimental use?

Proper reconstitution of recombinant IIV3-047R is crucial for maintaining its structural integrity and functional properties. The recommended reconstitution protocol involves several critical steps:

  • Briefly centrifuge the vial containing lyophilized IIV3-047R before opening to ensure the protein is at the bottom of the container.

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (with 50% being the default recommendation) to enhance stability during storage.

  • Aliquot the reconstituted protein into multiple small volumes to minimize freeze-thaw cycles.

  • Store the aliquots at -20°C or -80°C for long-term storage.

This methodical reconstitution approach helps maintain protein stability while preventing aggregation and degradation that might occur during repeated freeze-thaw cycles, which is particularly important for membrane proteins that tend to be less stable in solution compared to soluble proteins .

What are the optimal storage conditions for maintaining IIV3-047R stability?

To maximize the stability and activity of recombinant IIV3-047R, researchers should adhere to the following storage guidelines:

  • Store the lyophilized powder at -20°C or -80°C upon receipt.

  • After reconstitution, store working aliquots at 4°C for up to one week for ongoing experiments.

  • For longer storage, keep reconstituted protein at -20°C or -80°C in small aliquots containing glycerol (recommended final concentration: 50%).

  • Avoid repeated freeze-thaw cycles, as they can cause protein denaturation and loss of activity.

  • For functional assays, verify activity after storage using appropriate activity assays to ensure the protein remains functional.

These storage recommendations are designed to preserve both the structural and functional integrity of the recombinant protein. Membrane proteins like IIV3-047R are particularly sensitive to storage conditions, making proper handling essential for reliable experimental outcomes .

What structural domains have been identified in IIV3-047R and what are their predicted functions?

Analysis of the IIV3-047R amino acid sequence reveals several potentially important structural domains that may contribute to its function as a membrane protein:

  • N-terminal region (amino acids 1-200): Contains multiple cysteine residues that likely form disulfide bonds important for protein folding and stability. This region includes the sequence motifs "CDCWDCSA" and "CCFTCPN" which suggest potential metal-binding capabilities or specialized structural elements.

  • Central proline-rich region (approximately amino acids 290-360): Characterized by numerous proline residues and repeating "PP" motifs. Proline-rich regions often serve as binding sites for other proteins, particularly those containing SH3 domains. This region might mediate protein-protein interactions important for viral assembly or host-pathogen interactions.

  • C-terminal hydrophobic region (approximately amino acids 370-407): Contains a stretch of hydrophobic amino acids (LTFVGLVLALVIY) that likely forms a transmembrane domain, anchoring the protein in viral or cellular membranes.

For researchers investigating the structure-function relationship of IIV3-047R, computational prediction tools such as TMHMM, TOPCONS, or Phobius can be employed to predict transmembrane regions. For identifying functional domains, programs like InterProScan, SMART, or Pfam provide additional insights. Experimental validation of these predictions would require techniques such as limited proteolysis coupled with mass spectrometry, or deletion mutagenesis followed by functional assays .

What expression systems are optimal for producing functional recombinant IIV3-047R?

While E. coli is the documented expression system for recombinant IIV3-047R production, researchers working with membrane proteins may consider alternative expression platforms based on experimental needs:

  • E. coli-based expression:

    • Advantages: Fast growth, high protein yields, cost-effective, genetically tractable

    • Methodological considerations: Use specialized strains (e.g., C41/C43, Rosetta) designed for membrane protein expression; optimize induction conditions (temperature, IPTG concentration, induction time); consider fusion partners like MBP or SUMO to enhance solubility

    • Limitations: Lack of post-translational modifications, potential improper folding of complex membrane proteins

  • Insect cell expression systems:

    • Advantages: More natural environment for a virus that infects invertebrates, proper post-translational modifications, better folding of complex proteins

    • Methodological approach: Construct a recombinant baculovirus expressing IIV3-047R, infect Sf9 or High Five insect cells, optimize MOI and harvest time

    • Applications: Structural studies, functional assays requiring properly folded protein

  • Mammalian cell expression:

    • Advantages: Highest likelihood of proper folding and relevant post-translational modifications

    • Methodological approach: Transfect HEK293 or CHO cells with IIV3-047R expression construct, establish stable cell lines for consistent production

    • Applications: Studies involving host-protein interactions, functional characterization

For each expression system, optimization of purification protocols is crucial. For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin should be followed by size exclusion chromatography to achieve high purity. For membrane proteins like IIV3-047R, inclusion of appropriate detergents (e.g., DDM, LMNG) during purification is essential to maintain protein stability and native conformation .

What analytical techniques are most effective for characterizing the membrane integration and topology of IIV3-047R?

Investigating the membrane integration and topology of IIV3-047R requires a multi-faceted approach combining computational predictions with experimental validation:

  • Computational prediction methods:

    • Hydropathy analysis: Programs like TMHMM, Phobius, or TOPCONS can predict transmembrane domains based on hydrophobicity patterns

    • Topology prediction: Tools such as MEMSAT or OCTOPUS can predict the orientation of transmembrane segments

    • Methodological implementation: Compare results from multiple prediction algorithms to identify consensus transmembrane regions

  • Biochemical approaches to experimental validation:

    • Protease protection assays: Expose membrane vesicles containing IIV3-047R to proteases; protected fragments indicate membrane-embedded regions

    • Cysteine accessibility methods: Introduce cysteine residues at specific positions and test their accessibility to membrane-impermeable sulfhydryl reagents

    • Glycosylation mapping: Insert glycosylation sites at various positions; glycosylation occurs only on luminal/extracellular domains

  • Biophysical characterization methods:

    • Circular dichroism (CD) spectroscopy: Estimate secondary structure content (α-helices vs. β-sheets)

    • Fourier-transform infrared spectroscopy (FTIR): Assess secondary structure in membrane environments

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identify solvent-protected regions corresponding to membrane-embedded domains

  • Advanced structural determination techniques:

    • Cryo-electron microscopy: For high-resolution structural determination when protein can be purified in sufficient quantities

    • Solid-state NMR: Particularly suitable for membrane proteins in lipid environments

    • X-ray crystallography: If IIV3-047R can be crystallized, potentially with the aid of crystallization chaperones

These complementary approaches provide a comprehensive view of how IIV3-047R integrates into membranes, which is crucial for understanding its functional role in the viral life cycle .

How can site-directed mutagenesis be applied to study structure-function relationships in IIV3-047R?

Site-directed mutagenesis is a powerful approach for investigating structure-function relationships in IIV3-047R. A systematic mutagenesis strategy should target specific residues or regions based on sequence analysis and structural predictions:

  • Experimental design strategy:

    • Alanine scanning: Systematically replace conserved or functionally predicted important residues with alanine to assess their contribution to protein function

    • Conservative vs. non-conservative substitutions: Replace residues with similar amino acids (conservative) or dissimilar ones (non-conservative) to probe the chemical basis of function

    • Domain deletion/swapping: Remove or exchange entire domains to determine their functional contribution

  • Key regions for targeted mutagenesis in IIV3-047R:

    • Cysteine residues: Mutate cysteines (particularly those in patterns like CDCWDCSA) to alanine to disrupt potential disulfide bonds

    • Proline-rich region: Generate deletion or substitution mutants in the proline-rich central region to investigate protein-protein interactions

    • Predicted transmembrane domain: Introduce charged residues into the hydrophobic C-terminal region to disrupt membrane insertion

  • Functional assay development:

    • Membrane localization assays: Use fluorescent protein fusions to determine if mutations affect proper membrane targeting

    • Protein-protein interaction studies: Employ co-immunoprecipitation or proximity labeling to identify interaction partners and assess how mutations affect these interactions

    • Viral infectivity assays: If working with viral systems, test how mutations in recombinant IIV3-047R affect viral assembly or infectivity

  • Data analysis and interpretation:

    • Structure-based mapping: Map mutations onto predicted or experimentally determined structures to correlate position with functional effects

    • Evolutionary conservation analysis: Compare mutational effects with evolutionary conservation to identify functionally critical regions

    • Molecular dynamics simulations: Complement experimental data with computational simulations to understand how mutations affect protein dynamics

This systematic mutagenesis approach provides insights into which regions and specific residues are critical for IIV3-047R function, membrane integration, and potential interactions with other viral or host proteins .

What approaches can be used to study protein-protein interactions involving IIV3-047R?

Investigating the protein interaction network of IIV3-047R is crucial for understanding its functional role in viral biology. Several complementary approaches can be employed:

  • Co-immunoprecipitation (Co-IP) strategies:

    • Experimental approach: Express tagged IIV3-047R in relevant cell systems, lyse cells under conditions that preserve protein-protein interactions, immunoprecipitate using tag-specific antibodies, and identify co-precipitating proteins by western blot or mass spectrometry

    • Methodological considerations: Use mild detergents (e.g., digitonin, CHAPS) that maintain membrane protein interactions; include appropriate controls (tag-only, irrelevant membrane protein)

    • Data analysis: Compare interactome profiles between wild-type and mutant IIV3-047R to identify interaction determinants

  • Proximity-based labeling techniques:

    • BioID approach: Fuse IIV3-047R to a biotin ligase (BirA*), express in cells, add biotin to media, then purify and identify biotinylated proteins that were in proximity to IIV3-047R

    • APEX2 approach: Fuse IIV3-047R to APEX2 peroxidase, add biotin-phenol and H₂O₂ for rapid labeling of proximal proteins

    • Applications: These methods are particularly valuable for capturing transient interactions and for studying membrane proteins in their native environment

  • Yeast two-hybrid system adaptations:

    • Split-ubiquitin membrane yeast two-hybrid: Modified for membrane proteins, where interaction reconstitutes ubiquitin, leading to reporter gene activation

    • MYTH (Membrane Yeast Two-Hybrid): Specifically designed for identifying interactions involving integral membrane proteins

    • Screening strategy: Screen IIV3-047R against viral protein libraries or host cDNA libraries to identify interaction partners

  • Advanced biophysical methods:

    • Surface plasmon resonance (SPR): Measure direct binding between purified IIV3-047R and candidate interaction partners

    • Microscale thermophoresis (MST): Determine binding affinities in solution with minimal protein consumption

    • Förster resonance energy transfer (FRET): Assess protein-protein interactions in living cells using fluorescently tagged proteins

A comprehensive investigation would employ multiple complementary approaches, starting with unbiased screening methods (proximity labeling, MYTH) followed by validation and detailed characterization using directed approaches (Co-IP, SPR, FRET) .

How does the amino acid composition of IIV3-047R inform its potential functional properties?

Detailed analysis of the IIV3-047R amino acid sequence provides valuable insights into its potential functional properties:

  • Distinctive sequence features:

    • Cysteine content: The protein contains multiple clustered cysteine residues (e.g., CDCWDCSA, CCFTCPN motifs), suggesting the formation of disulfide bonds that could be critical for structural stability or redox-sensitive functions

    • Proline-rich region: The unusual concentration of proline residues (DPPPQPKPQPPPDPPKPPPDPPKPDPPPPPPPKPTPPPDPPKPKPDPVPPPKPTPPPPKPTPPPP) indicates a potentially disordered region that might serve as a molecular recognition element

    • C-terminal hydrophobic sequence: The C-terminus contains a clear hydrophobic stretch consistent with a transmembrane domain

  • Comparative analysis table of domain characteristics:

DomainAmino Acid PositionKey FeaturesPotential Functions
N-terminal domain1-200Cysteine-rich, hydrophilicProtein-protein interactions, possible catalytic activity
Central proline-rich domain201-370High proline content, repeating PP motifsBinding scaffold, signal transduction, conformational flexibility
C-terminal hydrophobic domain371-407Predominantly hydrophobic residuesMembrane anchoring, viral envelope integration
  • Functional implications based on sequence characteristics:

    • Viral assembly role: The combination of a membrane anchor with interaction domains suggests involvement in organizing viral structural components during assembly

    • Host interaction potential: Proline-rich regions often bind to SH3 domain-containing host proteins, potentially modulating host cell signaling or defense mechanisms

    • Conformational plasticity: The proline-rich region may allow the protein to adopt multiple conformations in response to environmental changes during the viral life cycle

This detailed sequence analysis provides a foundation for hypothesis generation and experimental design to elucidate the specific functions of IIV3-047R in the viral life cycle and its interactions with host components .

What purification strategies are most effective for obtaining highly pure IIV3-047R protein for functional and structural studies?

Purifying membrane proteins like IIV3-047R presents unique challenges requiring specialized approaches to obtain preparations suitable for downstream applications:

  • Extraction and solubilization optimization:

    • Detergent screening protocol:

      1. Prepare membrane fractions containing expressed IIV3-047R

      2. Aliquot membranes and test solubilization with different detergents (DDM, LMNG, GDN, OG, Triton X-100)

      3. Analyze solubilization efficiency by SDS-PAGE and western blotting

      4. Select detergents providing >80% extraction with minimal aggregation

    • Methodological considerations: Maintain consistent protein:detergent ratios (typically 1:10-1:20); include protease inhibitors; control temperature during extraction (usually 4°C)

  • Multi-step purification strategy:

    • First step - Affinity chromatography:

      1. Load solubilized lysate onto Ni-NTA resin (for His-tagged IIV3-047R)

      2. Wash extensively with increasing imidazole concentrations (10-40 mM)

      3. Elute with high imidazole (250-300 mM)

      4. Critical parameters: Include detergent at CMC+0.05% in all buffers; consider adding glycerol (10%) for stability

    • Second step - Size exclusion chromatography:

      1. Concentrate affinity-purified protein (avoid excessive concentration)

      2. Inject onto appropriate SEC column (Superdex 200 for IIV3-047R size range)

      3. Collect fractions corresponding to monomeric protein

      4. Verify monodispersity by dynamic light scattering

  • Quality control assessment:

    • Purity analysis: SDS-PAGE (>90% purity) and mass spectrometry for identity confirmation

    • Homogeneity verification: Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to confirm monodispersity and oligomeric state

    • Functionality tests: Circular dichroism to verify secondary structure content; thermal shift assays to assess stability

  • Alternative purification approaches:

    • Detergent-free methods:

      1. Styrene-maleic acid copolymer (SMA) extraction directly from membranes

      2. Membrane scaffold protein (MSP) nanodiscs for detergent removal after initial purification

      3. Amphipol exchange for improved stability during structural studies

    • Advantages: Better preservation of native lipid environment; improved stability; potential for higher activity

This systematic purification workflow, with appropriate quality control checkpoints, enables researchers to obtain highly pure, homogeneous, and functional IIV3-047R suitable for both biochemical and structural studies .

How does IIV3-047R compare to equivalent proteins in other viral systems?

Although IIV3-047R is a putative membrane protein specific to Invertebrate iridescent virus 3, comparing it to membrane proteins from other viral systems can provide valuable context for understanding its potential functions:

  • Structural homology considerations:

    • IIV3-047R's proline-rich region is unusual among viral membrane proteins, which typically contain more regular secondary structure elements

    • The cysteine-rich N-terminal domain shares some features with zinc-finger domains found in nucleic acid-binding proteins from other viruses

    • Unlike many viral envelope glycoproteins, IIV3-047R lacks apparent glycosylation sites, suggesting different functional roles

  • Functional comparisons with other viral systems:

    • Unlike fusion proteins (such as influenza hemagglutinin or HIV env), IIV3-047R lacks clear fusion peptide motifs

    • The proline-rich region resembles scaffolding domains seen in some bacteriophage proteins involved in capsid assembly

    • The membrane topology (single transmembrane domain with large N-terminal region) is reminiscent of coronaviral E proteins, which function in viral assembly

  • Experimental approaches for comparative analysis:

    • Homology modeling against structurally characterized viral membrane proteins

    • Heterologous expression studies in different viral systems to assess functional conservation

    • Complementation assays with membrane protein-deficient viruses to test functional equivalence

Comparative analysis across viral systems provides an evolutionary context for understanding IIV3-047R's role in the viral life cycle and may suggest novel approaches for experimental investigation based on established methodologies from better-characterized viral systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.