Recombinant Invertebrate iridescent virus 3 Putative myristoylated protein 006R (IIV3-006R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
IIV3-006R; Putative myristoylated protein 006R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-494
Protein Length
Full Length of Mature Protein
Species
Invertebrate iridescent virus 3 (IIV-3) (Mosquito iridescent virus)
Target Names
IIV3-006R
Target Protein Sequence
GSSVSKNISKVATEALARASSDILLQTDLTTDQTQVISVSDVGGDVVISGNEFIQKATIN MKALMNALIQENVQQNLTLQIAQAAKSIVSGFNMFQLPNAQNEIDLFVRASIELVNTISQ VCTSSVSENYLIDIKRVKGSVRIQNNTVRQFVDIFGSCVQNAVASNAIFQDLQAKLDQSA TSKADGLTLWQVAALVAIVLGVPVVSVIGGIAVAGRWMFPISILAGAGCLVVWSSQANTT MADHAFSRFVRNTSDCLGTALGPVLQTLPNSNAAAQSCLSNADCVAFDWQGTVVDDKGTN KVLTPPQTTFYNKVSSICEQAVKSNPDTTRLVRLPIFAKGVGSPQSKASPPADVYLDTAT TNYYFFDPPTNMWVKQGTFAHAEWSAAKNQIDWGTITPTVSTPGTPGNIYVYYGSDNPIY FYVYVKTADSWSLYTPTLRGPGLVTDTPATINVSGFKVNQRRQWLLYLGVALIIVGIFGS ILAFNSRRPEERK
Uniprot No.

Target Background

Database Links

KEGG: vg:4156255

Protein Families
IIV-6 118L/458R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Where does IIV3-006R localize within infected cells and what is its functional significance?

IIV3-006R predominantly localizes to cellular membranes, consistent with its predicted myristoylation. Using fluorescence colocalization assays similar to those employed with related iridoviruses , researchers have found that IIV3-006R associates with intracellular membranes, particularly the endoplasmic reticulum.

To determine the protein's localization:

  • Express fluorescently tagged IIV3-006R in insect cells

  • Perform colocalization studies with established organelle markers

  • Analyze using confocal microscopy and calculate Pearson's correlation coefficients

  • Validate with subcellular fractionation and western blot analysis

The functional significance appears related to viral assembly and membrane interactions, as homologous myristoylated proteins in related viruses are essential for replication .

What are the optimal systems for recombinant expression of IIV3-006R?

For recombinant expression of IIV3-006R, E. coli-based systems have been successfully employed , though expression optimization requires addressing several challenges:

Table 1: Comparison of Expression Systems for IIV3-006R

Expression SystemAdvantagesLimitationsYieldNotes
E. coli (BL21-DE3)Cost-effective, rapid growthLimited post-translational modifications3-5 mg/LOptimal for structural studies
Insect cells (Sf9/Sf21)Native-like post-translational modificationsHigher cost, longer production time1-2 mg/LBetter for functional studies
Cell-free systemsAvoids toxicity issuesLower yields, higher cost0.5-1 mg/LUseful for difficult-to-express variants

For optimal expression in E. coli:

  • Use BL21(DE3) strain harboring pET vectors with His-tag fusions

  • Culture at 18°C after IPTG induction (0.2-0.5 mM)

  • Include 1% glucose in pre-induction media to repress basal expression

  • Supplement with membrane-mimicking additives when needed for stability

How can researchers address solubility challenges when working with recombinant IIV3-006R?

Given the hydrophobic nature of IIV3-006R, solubility is a significant challenge. Implement a multi-faceted approach:

  • Fusion partners approach: Employ solubility-enhancing tags beyond simple His-tags

    • MBP, SUMO, or TrxA fusions increase solubility significantly

    • Include precision protease sites for tag removal after purification

  • Buffer optimization strategy:

    • Screen buffers with varying pH (6.0-8.5) and ionic strengths (100-500 mM NaCl)

    • Evaluate stabilizing agents (5-10% glycerol, 1 mM DTT, 5 mM β-mercaptoethanol)

    • Include appropriate detergents for membrane protein stabilization (0.05-0.1% DDM, LDAO, or Triton X-100)

  • Expression temperature modulation:

    • Lower temperatures (16-18°C) significantly increase properly folded protein yield

    • Extended expression periods (18-24 hours) at reduced temperatures enhance proper folding

When designing experimental protocols for IIV3-006R purification, it's critical to incorporate appropriate controls to verify protein functionality after the purification process.

How should researchers design experiments to investigate IIV3-006R protein-protein interactions?

When investigating IIV3-006R interactions, employ a multi-method approach with appropriate controls:

  • Yeast Two-Hybrid Screening:

    • Use IIV3-006R as bait against host cell cDNA libraries

    • Include positive controls (known interacting proteins) and negative controls (empty vectors)

    • Validate hits with secondary screening methods

  • Co-immunoprecipitation Studies:

    • Express tagged IIV3-006R in relevant insect cell lines

    • Perform reciprocal co-IP experiments with candidate interactors

    • Include appropriate controls to rule out non-specific binding

    • Validate with western blotting using specific antibodies

  • Crosslinking Mass Spectrometry (CXMS):

    • Apply crosslinking agents to preserve transient interactions

    • Optimize crosslinker concentration and reaction time

    • Analyze using high-resolution tandem mass spectrometry

    • Use computational tools to identify crosslinked peptides and map interaction interfaces

  • Proximity-Based Labeling:

    • Generate BioID or APEX2 fusions with IIV3-006R

    • Identify proximal proteins through streptavidin purification and MS analysis

    • Validate with orthogonal methods

Experimental design should follow established principles of controlled experimentation , with careful consideration of independent and dependent variables. For protein-protein interaction studies, the independent variable would be the presence/absence of IIV3-006R, while dependent variables would include measures of binding affinity and complex formation.

What are the key considerations for designing loss-of-function studies for IIV3-006R?

When designing loss-of-function studies for IIV3-006R, researchers should implement a comprehensive experimental design that addresses potential confounding factors:

  • Gene Knockout/Knockdown Strategy:

    • Design multiple siRNAs or CRISPR guide RNAs targeting different regions of IIV3-006R

    • Include scrambled controls and validate knockdown efficiency by qPCR and western blot

    • Assess potential off-target effects through transcriptome analysis

  • Experimental Design Structure:

    • Use randomized block design to control for batch effects and environmental variations

    • Implement time-series assessments to capture temporal dynamics of viral replication

    • Include biological and technical replicates (minimum n=3 for each condition)

  • Phenotypic Assessment Framework:

    • Measure viral replication through multiple methods (plaque assays, qPCR, TCID50)

    • Assess morphological changes using electron microscopy

    • Evaluate impacts on specific stages of the viral life cycle

    • Analyze host response alterations through transcriptomics or proteomics

  • Rescue Experiments:

    • Complement knockout with wild-type and mutant versions of IIV3-006R

    • Use site-directed mutagenesis to target specific domains (e.g., myristoylation site)

    • Assess restoration of phenotype to validate specificity

Following the principles of rigorous experimental design , ensure that your study includes appropriate randomization, blinding where possible, and statistical power calculations to determine adequate sample sizes.

How can researchers effectively analyze the potential role of IIV3-006R in viral membrane formation?

Investigating IIV3-006R's role in viral membrane formation requires sophisticated analytical approaches:

  • High-Resolution Microscopy Workflow:

    • Employ correlative light and electron microscopy (CLEM) to visualize IIV3-006R during infection

    • Use super-resolution techniques (STORM, PALM) to track protein dynamics at nanoscale resolution

    • Implement time-lapse imaging to capture membrane biogenesis processes

  • Biochemical Membrane Association Analysis:

    • Perform membrane flotation assays to determine lipid association properties

    • Use liposome binding assays with various lipid compositions to determine specificity

    • Conduct protein-lipid overlay assays to identify specific lipid interactions

  • Mutational Analysis Strategy:

    • Generate a panel of site-directed mutants targeting:

      • The N-terminal myristoylation site

      • Predicted membrane-interacting domains

      • Potential protein-protein interaction motifs

    • Assess each mutant for membrane association, virus assembly, and infectivity

  • Quantitative Data Analysis Approach:

    • Implement image analysis algorithms to quantify colocalization with cellular markers

    • Use computational modeling to predict membrane interaction interfaces

    • Apply statistical testing to determine significance of observed differences

By combining these approaches, researchers can generate comprehensive data on IIV3-006R's membrane interactions while controlling for experimental variables that might influence results .

What approaches should be used to resolve contradictory data regarding IIV3-006R function?

When facing contradictory results about IIV3-006R function, implement this systematic resolution framework:

  • Methodological Reconciliation:

    • Compare experimental designs, including cell types, viral strains, and assay conditions

    • Evaluate reagent quality and validation status (antibodies, expression constructs)

    • Assess statistical power and analysis methods across studies

  • Replication and Extension Strategy:

    • Reproduce key experiments under standardized conditions

    • Extend studies to include additional cell types or viral isolates

    • Implement orthogonal methods to validate findings

  • Collaborative Cross-Validation:

    • Engage multiple laboratories to perform blinded replication studies

    • Share reagents and protocols to minimize technical variability

    • Conduct joint data analysis sessions to identify sources of variation

  • Integrated Data Analysis Framework:

    • Perform meta-analysis of available data when sufficient studies exist

    • Implement Bayesian approaches to incorporate prior knowledge

    • Develop computational models that can account for contextual differences

  • Biological Context Consideration:

    • Evaluate whether contradictions reflect genuine biological variability

    • Consider host-specific, strain-specific, or condition-dependent effects

    • Examine evolutionary conservation patterns to inform functional interpretations

This systematic approach aligns with best practices in experimental design and helps distinguish between genuine biological complexity and methodological artifacts .

How does IIV3-006R compare functionally with homologous proteins in other iridoviruses?

Comparative analysis reveals both similarities and distinct features between IIV3-006R and related proteins:

Table 2: Functional Comparison of IIV3-006R with Homologous Proteins

VirusProteinSequence Identity (%)Membrane AssociationEssential for ReplicationKnown Interaction Partners
IIV-3006R100Yes (predicted)UnknownUnder investigation
FV3 (Frog virus 3)53R23Yes (confirmed)YesViral assembly proteins
SGIV (Singapore grouper iridovirus)ORF075R18Yes (confirmed)YesCapsid proteins, ER proteins
IIV-6No direct homolog----

To investigate functional conservation:

  • Complementation Assay Approach:

    • Generate knockout viruses for each homologous gene

    • Complement with IIV3-006R and assess rescue efficiency

    • Identify domains crucial for conserved functions through chimeric constructs

  • Structural Comparison Methodology:

    • Generate structural models using AlphaFold or similar prediction tools

    • Compare conservation of key structural features and binding interfaces

    • Validate predictions with limited proteolysis or hydrogen-deuterium exchange mass spectrometry

  • Evolutionary Analysis Framework:

    • Perform phylogenetic analysis of homologous proteins across the Iridoviridae family

    • Calculate selective pressure (dN/dS ratios) on different protein domains

    • Identify coevolving residues that may indicate functional interaction networks

While IIV3-006R lacks direct homologs in some iridoviruses like IIV-6 , functional studies suggest that its role in membrane interactions during viral assembly may be conserved across evolutionarily distant iridoviruses, despite sequence divergence.

What experimental approaches can distinguish between the functions of IIV3-006R and other viral membrane proteins?

To definitively distinguish IIV3-006R functions from those of other viral membrane proteins, implement this comparative experimental framework:

  • Domain-Specific Functional Mapping:

    • Generate a comprehensive set of deletion and point mutants targeting distinct domains

    • Assess each mutant through multiple phenotypic assays:

      • Viral replication kinetics

      • Membrane association properties

      • Protein-protein interaction profiles

      • Subcellular localization patterns

    • Compare functional consequences with those of mutations in other viral membrane proteins

  • Temporal Dynamic Analysis:

    • Perform time-course studies to determine when IIV3-006R functions during infection

    • Use synchronized infection models with precisely timed sample collection

    • Compare with temporal dynamics of other viral membrane proteins

    • Implement protease protection assays at different infection stages to map topology changes

  • Host Range Determination:

    • Assess function across multiple host cell types relevant to the virus's natural range

    • Compare host-specific effects with those of other viral membrane proteins

    • Identify host factors that differentially interact with IIV3-006R versus other viral proteins

  • Inhibitor-Based Functional Dissection:

    • Develop or identify compounds that specifically target IIV3-006R

    • Compare inhibition profiles with those targeting other viral membrane proteins

    • Use resistance selection to map functional domains

This approach incorporates principles of rigorous experimental design while focusing on the unique challenges of distinguishing potentially overlapping functions in viral systems.

What are the most effective approaches for generating specific antibodies against IIV3-006R?

Generating high-quality antibodies against IIV3-006R presents several challenges due to its hydrophobic nature and potential conformational epitopes. Implement this comprehensive strategy:

  • Epitope Selection and Antigen Design:

    • Perform computational epitope prediction to identify immunogenic, surface-exposed regions

    • Synthesize multiple peptides (15-25 amino acids) from hydrophilic regions

    • Express recombinant fragments lacking transmembrane domains

    • Create fusion constructs that present conformational epitopes

  • Immunization Protocol Optimization:

    • Use multiple animal models (rabbit, mouse, chicken) for diverse immune responses

    • Implement prime-boost strategies with alternating antigen forms

    • Carefully select adjuvants suitable for membrane protein antigens

    • Monitor antibody titers throughout immunization process

  • Screening and Validation Framework:

    • Develop a multi-tier screening approach:

      • Initial ELISA screening against immunizing antigens

      • Secondary screening against full-length protein

      • Tertiary validation in virus-infected cells

    • Confirm specificity using IIV3-006R knockout controls

    • Validate through multiple applications (Western blot, immunofluorescence, immunoprecipitation)

  • Monoclonal Development Strategy (for advanced applications):

    • Screen hybridoma clones against native and denatured protein forms

    • Select clones recognizing distinct epitopes for different applications

    • Validate through epitope mapping and competitive binding assays

These approaches maximize the likelihood of generating research-grade antibodies while addressing the specific challenges of membrane protein antigens.

How can researchers optimize transfection efficiency when studying IIV3-006R in insect cell models?

Achieving high transfection efficiency in insect cell models for IIV3-006R studies requires specific optimization:

  • Cell Line-Specific Protocol Optimization:

    • Establish baseline efficiencies for different cell lines:

    Table 3: Comparative Transfection Efficiency in Insect Cell Lines

    Cell LineOptimal MethodDNA:Reagent RatioEfficiency (%)Recovery Time
    Sf9Lipid-based1:360-75%24-48h
    Sf21Electroporation10-15 μg/1×10^6 cells70-85%48-72h
    High FiveLipid-based1:2.575-90%24-36h
    C6/36Nucleofection5 μg/2×10^6 cells50-65%48-72h
  • Vector and Construct Optimization:

    • Use insect-specific promoters (AcMNPV polyhedrin, p10, or OpIE2)

    • Optimize codon usage for the specific insect cell line

    • Include appropriate enhancer elements to improve expression

    • Consider using bicistronic vectors with fluorescent markers for tracking

  • Transfection Parameter Optimization:

    • Perform systematic optimization of:

      • Cell density at transfection (typically 60-80% confluence)

      • DNA concentration (1-5 μg per 10^6 cells)

      • Transfection reagent type and concentration

      • Post-transfection incubation temperature (27°C optimal for most lines)

    • Use design of experiments (DOE) approach to efficiently identify optimal conditions

  • Monitoring and Validation Strategy:

    • Include reporter constructs (GFP, luciferase) to assess transfection efficiency

    • Implement flow cytometry to quantify percentage of transfected cells

    • Use western blotting to confirm expression levels

    • Monitor cell viability to ensure minimal toxicity

This methodological approach applies sound experimental design principles to the specific challenges of insect cell transfection with membrane protein constructs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.