Recombinant Invertebrate iridescent virus 3 Transmembrane protein 022L (IIV3-022L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order remarks. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
IIV3-022L; Transmembrane protein 022L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Invertebrate iridescent virus 3 (IIV-3) (Mosquito iridescent virus)
Target Names
IIV3-022L
Target Protein Sequence
MSFVHKLPTFYTAGVGAIIGGLSLRFNGAKFLSDWYINKYNDSVPAWSLQTCHWAGIALY CVGWVTLASVIYLKHRDNSILKGSILSCIVISAVWSILEYNQDMFVSNPKLPLISCAMLV SSLAALVALKYHIKDIFTILGAAIIIILAEYVVLPYQRQYNIVDGIGLPLLLLGFFILYQ VFSVPNPSTPTGVMVPKPEDEWDIEMAPLNHRDRQVPESELENVK
Uniprot No.

Target Background

Database Links

KEGG: vg:4156271

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is Invertebrate iridescent virus 3 and its transmembrane protein 022L?

Invertebrate iridescent virus 3 (IIV3), also known as mosquito iridescent virus, belongs to the Chloriridovirus genus within the Iridoviridae family. This large, icosahedral, double-stranded DNA virus primarily infects mosquito species. The transmembrane protein 022L is encoded by open reading frame 022L in the viral genome and functions as an integral membrane protein.

For researchers seeking to study this protein, the initial characterization should include:

  • Genome position analysis using bioinformatics tools like BLAST against the complete IIV3 genome

  • Multiple sequence alignment with homologous proteins from related viruses

  • Hydrophobicity profiling using algorithms such as Kyte-Doolittle or TMHMM to identify transmembrane domains

  • Prediction of protein topology using tools like TOPCONS or MEMSAT

What genetic and structural characteristics define IIV3-022L?

IIV3-022L is characterized by:

  • Approximately 210-230 amino acids (exact length may vary based on strain)

  • 2-3 predicted transmembrane domains

  • N-terminal signal sequence

  • Conserved cysteine residues that likely form disulfide bonds

For structural analysis, researchers should consider:

  • Secondary structure prediction using methods like PSIPRED or JPred

  • Tertiary structure modeling through homology modeling or ab initio approaches using Rosetta or AlphaFold

  • Molecular dynamics simulations to evaluate stability of predicted structures

  • Experimental validation using circular dichroism spectroscopy to confirm secondary structure elements

How do recombinant expression systems for IIV3-022L compare?

Researchers have several options for expressing recombinant IIV3-022L:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliCost-effective, rapid growthOften forms inclusion bodies requiring refolding1-5 mg/L culture
Insect cells (Sf9, Hi5)Native-like post-translational modificationsHigher cost, longer expression time5-15 mg/L culture
Mammalian cellsMost authentic processingLowest yield, highest cost0.5-3 mg/L culture
Cell-free systemsAvoids toxicity issuesLimited scale, expensive0.1-1 mg/reaction

For optimal results, insect cell expression is frequently preferred as it balances authentic processing with reasonable yields. Successful expression typically requires:

  • Codon optimization for the selected expression system

  • Addition of purification tags (His6, GST, or MBP) positioned to avoid disrupting transmembrane domains

  • Careful selection of detergents for extraction and purification (e.g., DDM, LDAO, or Triton X-100)

  • Temperature optimization (often lower temperatures improve folding)

What expression vectors and constructs are most effective for producing functional recombinant IIV3-022L?

When designing expression constructs for IIV3-022L, consider:

Vector selection:

  • For insect cells: pFastBac or pVL1393 vectors with polyhedrin or p10 promoters

  • For E. coli: pET series vectors with T7 promoter and lac operator control

  • For mammalian cells: pCDNA3.1 or pCAGGS with CMV promoter

Construct design strategies:

  • Include fusion tags for detection and purification (His6, FLAG, or Strep-tag II)

  • Position tags at C-terminus to preserve native signal sequence processing

  • Include TEV or PreScission protease cleavage sites for tag removal

  • Consider incorporating fluorescent protein fusions (GFP, mCherry) for localization studies

  • Evaluate truncated constructs that exclude transmembrane domains for soluble domain expression

Validation approaches:

  • Western blot confirmation using tag-specific antibodies

  • Fluorescence microscopy to confirm membrane localization

  • Mass spectrometry to verify protein identity and integrity

What purification protocols maximize yield and activity of recombinant IIV3-022L?

Effective purification of IIV3-022L requires careful consideration of membrane protein properties:

Membrane protein extraction:

  • Cell lysis via sonication, microfluidization, or detergent solubilization

  • Screening of detergents (start with DDM, LMNG, or GDN)

  • Extraction at 4°C with protease inhibitors to prevent degradation

Purification workflow:

  • Initial capture via immobilized metal affinity chromatography (IMAC)

  • Secondary purification via size exclusion chromatography (SEC)

  • Optional ion exchange chromatography for higher purity

  • Consider amphipol or nanodisc reconstitution for long-term stability

Quality control metrics:

  • SEC-MALS to assess oligomeric state and homogeneity

  • Circular dichroism to confirm secondary structure integrity

  • Thermal shift assays to evaluate stability in different buffer conditions

  • SDS-PAGE with Coomassie staining to assess purity (aim for >95%)

How can researchers validate the structural integrity of purified IIV3-022L?

Multiple complementary techniques should be employed:

Biophysical characterization:

  • Circular dichroism spectroscopy to confirm secondary structure elements

  • Tryptophan fluorescence to assess tertiary folding

  • Dynamic light scattering to evaluate size distribution and aggregation state

  • Differential scanning calorimetry to determine thermal stability

Structural determination approaches:

  • Negative-stain electron microscopy for initial assessment

  • Cryo-electron microscopy for higher-resolution structural analysis

  • X-ray crystallography (challenging but potentially feasible with lipidic cubic phase)

  • Hydrogen-deuterium exchange mass spectrometry to probe dynamics and accessibility

Functional validation:

  • Lipid binding assays using fluorescently labeled lipids

  • Liposome flotation assays to confirm membrane association

  • Proteoliposome reconstitution to assess activity in a native-like environment

How does IIV3-022L interact with host cell membranes?

Understanding IIV3-022L membrane interactions requires specialized techniques:

Interaction analysis methods:

  • Surface plasmon resonance with immobilized lipid bilayers

  • Microscale thermophoresis for quantitative binding measurements

  • Liposome co-sedimentation assays to assess membrane association

  • Giant unilamellar vesicle (GUV) binding assays with fluorescently labeled protein

Membrane disruption assessment:

  • Calcein leakage assays to evaluate pore formation

  • Membrane fusion assays using fluorescently labeled liposomes

  • Atomic force microscopy to visualize membrane perturbations

  • Electrophysiology recordings to detect channel-like activities

Host-specificity investigations:

  • Compare binding to lipid compositions mimicking different host species

  • Evaluate pH-dependence of membrane interactions

  • Assess cholesterol and sphingolipid requirements for binding

What role does IIV3-022L play in viral infection mechanisms?

This protein likely functions in multiple stages of the viral lifecycle:

Entry mechanism studies:

  • Viral internalization assays with fluorescently labeled virions

  • Inhibition studies using anti-022L antibodies or peptides

  • Time-of-addition experiments to identify stage of action

  • Electron microscopy of virus-cell interactions

Functional mutagenesis approaches:

  • Alanine scanning of conserved residues

  • Charge reversal mutations at membrane interfaces

  • Disulfide bond mapping via cysteine mutagenesis

  • Domain swapping with related viral proteins

In vivo relevance:

  • Generation of 022L-deleted virus to assess replication competence

  • Complementation assays with mutant forms of 022L

  • Cross-species infection studies to evaluate host-range determinants

How can researchers study specific structural domains within IIV3-022L?

Domain-specific analysis requires targeted approaches:

Domain identification and isolation:

  • Limited proteolysis followed by mass spectrometry

  • In silico domain prediction using tools like SMART or InterPro

  • Expression of individual domains as soluble fragments

  • Antibody epitope mapping to identify accessible regions

Domain-specific functional assays:

  • Competitive inhibition using domain-specific peptides

  • Yeast two-hybrid screening with individual domains

  • Dominant-negative approaches with truncated constructs

  • FRET-based interaction studies between domains

Structural characterization of domains:

  • Solution NMR of soluble domains

  • X-ray crystallography of stable domains

  • Hydrogen-deuterium exchange to map domain boundaries

  • Crosslinking mass spectrometry to establish domain proximity

What are common challenges in expressing and purifying IIV3-022L?

Researchers frequently encounter several obstacles:

Expression challenges:

  • Toxicity to expression host (mitigate with tightly controlled induction)

  • Improper membrane insertion (optimize signal sequences)

  • Protein aggregation (screen expression temperatures and detergents)

  • Low expression levels (try fusion partners like MBP or SUMO)

Purification pitfalls:

  • Detergent-induced destabilization (screen detergent classes)

  • Co-purification of host proteins (incorporate additional purification steps)

  • Protein precipitation during concentration (identify stabilizing additives)

  • Tag inaccessibility (consider dual tagging strategies)

Quality control issues:

  • Heterogeneous glycosylation (use EndoH treatment or glycosylation-site mutants)

  • Disulfide bond scrambling (optimize oxidizing conditions)

  • Proteolysis during purification (increase protease inhibitor concentration)

  • Loss of cofactors or bound lipids (supplement during purification)

How can researchers address issues with protein misfolding of recombinant IIV3-022L?

Several strategies can improve folding outcomes:

Folding optimization approaches:

  • Screen expression temperature (typically lower temperatures improve folding)

  • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

  • Add chemical chaperones to culture media (glycerol, betaine)

  • Include stabilizing ligands during expression

Refolding strategies:

  • Systematic detergent screening for solubilization

  • Step-wise dialysis to remove denaturants

  • On-column refolding during purification

  • Bicelle or amphipol reconstitution

Stability enhancement:

  • Identify and mutate unstable regions based on sequence analysis

  • Engineer disulfide bonds to stabilize tertiary structure

  • Add stabilizing lipids during purification

  • Screen buffer additives (glycerol, arginine, sucrose)

What approaches can resolve data inconsistencies in IIV3-022L characterization studies?

When faced with conflicting data, consider:

Technical troubleshooting:

  • Validate antibody specificity with knockout controls

  • Perform multiple orthogonal assays to confirm findings

  • Ensure proper controls for post-translational modifications

  • Check for batch-to-batch variation in recombinant proteins

Experimental design improvements:

  • Replicate studies using different expression systems

  • Verify protein identity through mass spectrometry

  • Control for detergent effects in functional assays

  • Standardize protocols across research groups

Reconciliation strategies:

  • Identify species-specific differences in protein sequence

  • Consider strain variation effects on structure and function

  • Evaluate whether conflicting results reflect different physiological conditions

  • Develop consensus methods incorporating multiple approaches

What emerging techniques show promise for studying IIV3-022L interactions?

Several cutting-edge approaches offer new insights:

Advanced imaging technologies:

  • Super-resolution microscopy (STORM, PALM) for in situ localization

  • Correlative light and electron microscopy (CLEM) to connect structure and function

  • Cryo-electron tomography of virus particles to visualize 022L in native context

  • Label-free imaging using infrared nanospectroscopy

Interaction mapping technologies:

  • Proximity labeling approaches (BioID, APEX) to identify interaction partners

  • Single-molecule FRET to study conformational changes

  • Native mass spectrometry to characterize protein complexes

  • In-cell NMR to study dynamics in living cells

Computational approaches:

  • Molecular dynamics simulations in explicit membrane environments

  • Machine learning for interaction prediction

  • Coevolution analysis to predict structural contacts

  • Integrative modeling combining multiple experimental datasets

How might IIV3-022L research contribute to understanding broader viral membrane fusion mechanisms?

Research on IIV3-022L has implications beyond its specific virus:

Comparative virology opportunities:

  • Structural comparison with fusion proteins from enveloped viruses

  • Functional analysis alongside fusion proteins from other non-enveloped viruses

  • Evolutionary analysis to trace the origins of fusion mechanisms

  • Identification of conserved mechanistic principles across viral families

Fundamental membrane biology insights:

  • Protein-driven membrane deformation mechanisms

  • Lipid composition requirements for fusion events

  • Role of protein oligomerization in membrane manipulation

  • Energy requirements for membrane reorganization

Potential applications:

  • Development of broad-spectrum antiviral strategies targeting conserved fusion mechanisms

  • Design of membrane-active peptides based on IIV3-022L motifs

  • Creation of membrane fusion tools for biotechnology applications

  • Inspiration for drug delivery systems that cross cellular membranes

What comparative studies between IIV3-022L and other viral transmembrane proteins might yield valuable insights?

Strategic comparisons could accelerate understanding:

Cross-family comparative studies:

  • Comparison with transmembrane proteins from related iridoviruses (IIV6, FV3)

  • Functional parallels with fusion proteins from enveloped viruses (influenza HA, HIV Env)

  • Structural comparison with bacterial membrane insertion proteins

  • Evolutionary relationship with eukaryotic SNARE proteins

Structure-function relationships:

  • Mapping conserved functional motifs across diverse viral transmembrane proteins

  • Identifying convergent structural solutions to membrane penetration

  • Comparing lipid binding specificities across viral families

  • Assessing pH-dependent conformational changes across different viral fusion systems

Methodological opportunities:

  • Adapting successful expression strategies from well-studied viral proteins

  • Applying established functional assays from other viral systems

  • Leveraging structural information from related proteins for modeling

  • Developing chimeric proteins to identify functional domains

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.