Recombinant Invertebrate iridescent virus 3 Uncharacterized protein 004R (IIV3-004R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in your order notes if you have specific requirements. We will fulfill your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request but will incur additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
IIV3-004R; Uncharacterized protein 004R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-451
Protein Length
full length protein
Species
Invertebrate iridescent virus 3 (IIV-3) (Mosquito iridescent virus)
Target Names
IIV3-004R
Target Protein Sequence
MPPKNNQITYNIFKVDHRFALPRVRPKFPKFSELYLELLVNRSKVDPQLMNEPYVHRYDP VVSSGESMVNPVPPADDGRMVATTLKAVPRLSSVPNPSPAKPTQKPTISRESFVWESSAS IDPSPRVQKKSRGRPASSTPSIEPESISRYRQVKRSIISSYYKQVGEGAPSTTRRAADSE NERRPSEVREAPESRRRRETSETGSDKSKAPPPIKEIKKTFGNEENPLINVFEDYPQAKD EDDHKRELLFKFKRLRQTYPKVDIPDFTMLSNHETMKRTYDSTLRNLSIDSTVENYKSYL MMGFMACEMVLGKIGFDMEGYTQQQTLHMNKYEKLLVELGEKSYVPNSVNKWPVEVRLIG LMLFQTTIFIISKIIAKKTNVNLLQIYNNFSGLNEPPKVTRNGSSSGFASGTSSPLVFIP RTKRPSLVPSEKKMRGPSVTRDLAAEQERDA
Uniprot No.

Target Background

Database Links

KEGG: vg:4156253

Protein Families
IIV-6 067R family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Invertebrate iridescent virus 3 (IIV-3) and what is the significance of studying its proteins?

Invertebrate iridescent virus 3 (IIV-3), also known as Mosquito iridescent virus, belongs to the family Iridoviridae. This virus primarily infects mosquitoes and has been isolated from various mosquito species. The significance of studying IIV-3 proteins lies in understanding viral-host interactions, mechanisms of infection, and potential applications in biological control of insect vectors. IIV-3 contains several uncharacterized proteins including 004R, which presents an opportunity for novel discoveries in viral protein function and structure .

How does recombinant IIV3-004R differ from the native viral protein?

The commercially available recombinant IIV3-004R is produced in E. coli expression systems with an N-terminal His-tag for purification purposes. This differs from the native viral protein in several ways: (1) the addition of the His-tag may influence protein folding or function; (2) bacterial expression lacks eukaryotic post-translational modifications that might be present in the native viral protein; and (3) the recombinant protein is isolated from its natural viral context, potentially affecting its structural conformation. Researchers should consider these differences when interpreting experimental results using recombinant IIV3-004R .

What are the optimal expression and purification methods for recombinant IIV3-004R?

For expression of recombinant IIV3-004R, E. coli systems have been successfully utilized. The commercially available protein is expressed with an N-terminal His-tag to facilitate purification. The optimal protocol includes:

  • Transformation of expression plasmid containing the IIV3-004R sequence into an appropriate E. coli strain

  • Induction of protein expression under optimized conditions

  • Cell lysis under conditions that maintain protein stability

  • Affinity chromatography using Ni-NTA or similar matrices to capture the His-tagged protein

  • Additional purification steps such as ion exchange or size exclusion chromatography as needed

  • Final quality control by SDS-PAGE to ensure >90% purity

The purified protein is typically provided in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain stability .

What storage and handling recommendations ensure optimal activity of recombinant IIV3-004R?

Based on established protocols for recombinant IIV3-004R, the following storage and handling guidelines are recommended:

Storage ConditionRecommendation
Long-term storage-20°C to -80°C with aliquoting to prevent freeze-thaw cycles
Working solutionMaintain at 4°C for up to one week
ReconstitutionUse deionized sterile water to 0.1-1.0 mg/mL
StabilizationAdd glycerol to 5-50% final concentration (50% is recommended)

Critical considerations include avoiding repeated freeze-thaw cycles, brief centrifugation of the vial before opening, and proper aliquoting for multiple uses. These measures help prevent protein degradation and maintain functional integrity of the recombinant protein .

What analytical methods are most appropriate for structural characterization of IIV3-004R?

Given the uncharacterized nature of IIV3-004R, a multi-method approach to structural characterization is recommended:

  • Circular Dichroism (CD) Spectroscopy: To determine secondary structure composition (α-helices, β-sheets)

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): To assess oligomerization state and molecular weight in solution

  • X-ray Crystallography: For high-resolution 3D structure determination (requires successful crystallization)

  • Nuclear Magnetic Resonance (NMR): For solution structure and dynamics analysis (if protein size permits)

  • Cryo-Electron Microscopy: Particularly useful if IIV3-004R forms larger complexes

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): To map protein dynamics and solvent accessibility

  • Protein Threading and Homology Modeling: Computational approaches to predict structure based on the known amino acid sequence

Each method provides complementary information, and the choice depends on research questions and available resources.

How can researchers determine the potential function of this uncharacterized protein?

Determining the function of IIV3-004R requires a systematic approach combining computational predictions and experimental validation:

  • Sequence-Based Analysis:

    • Perform BLAST searches against characterized proteins

    • Identify conserved domains using InterPro, Pfam, or SMART databases

    • Apply tools like DeepFRI or ESM-1b for function prediction from sequence

  • Structural Approaches:

    • Predict binding pockets using CASTp or SiteMap

    • Perform molecular docking with potential ligands

    • Compare with structurally similar proteins using DALI or TM-align

  • Experimental Validation:

    • Conduct protein-protein interaction studies (pull-downs, Y2H, BioID)

    • Perform enzymatic activity assays based on computational predictions

    • Utilize viral infection models with IIV3-004R mutants or inhibitors

    • Implement CRISPR/Cas9 to modify the corresponding gene and observe phenotypic changes

  • Cellular Localization:

    • Express fluorescently tagged IIV3-004R in insect cells

    • Perform immunofluorescence with anti-IIV3-004R antibodies

    • Conduct subcellular fractionation experiments

This comprehensive approach increases the likelihood of accurately determining IIV3-004R's biological function.

What protein-protein interaction methods are suitable for identifying IIV3-004R binding partners?

Several complementary methods can be employed to identify potential binding partners of IIV3-004R:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Use His-tagged IIV3-004R as bait protein

    • Perform pull-down experiments with insect cell lysates

    • Identify binding partners through mass spectrometry

    • Validate interactions with specific antibodies

  • Yeast Two-Hybrid (Y2H) Screening:

    • Construct IIV3-004R as bait in appropriate vectors

    • Screen against insect cDNA libraries

    • Verify positive interactions through secondary assays

  • Proximity-Based Labeling:

    • Generate BioID or TurboID fusions with IIV3-004R

    • Express in relevant insect cells

    • Identify proximal proteins through biotin labeling and streptavidin purification

  • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI):

    • Immobilize purified IIV3-004R on sensor chips

    • Test binding with candidate proteins

    • Determine kinetic parameters of interactions

Each method has strengths and limitations, so a combination of approaches provides the most reliable results for identifying genuine interaction partners.

How can recombinant IIV3-004R be used to develop potential antiviral strategies?

Recombinant IIV3-004R offers several avenues for antiviral research and development:

  • High-Throughput Screening (HTS):

    • Develop binding or functional assays using purified IIV3-004R

    • Screen chemical libraries for molecules that interact with the protein

    • Identify compounds that potentially inhibit IIV3-004R function

  • Structure-Based Drug Design:

    • Utilize the 3D structure (experimental or predicted) of IIV3-004R

    • Identify potential druggable pockets

    • Design or virtually screen compounds targeting these sites

    • Validate candidates through binding and functional assays

  • Peptide Inhibitor Development:

    • Identify peptide sequences that bind to functionally important regions

    • Test their ability to interfere with protein function

    • Optimize lead peptides for stability and cellular uptake

  • Antibody Development:

    • Generate monoclonal antibodies against recombinant IIV3-004R

    • Test their ability to neutralize viral infection in cellular models

    • Characterize epitopes and mechanisms of neutralization

  • CRISPR-Based Approaches:

    • Develop guide RNAs targeting the 004R gene

    • Test CRISPR interference or knockout strategies in infection models

These approaches could lead to novel antivirals not only for IIV-3 but potentially for related viruses if functional conservation exists.

What challenges exist in crystallizing IIV3-004R for high-resolution structural studies?

Crystallizing an uncharacterized protein like IIV3-004R presents several challenges:

  • Protein Purity and Homogeneity:

    • The protein must be >95% pure with minimal degradation

    • Batch-to-batch consistency is essential for reproducible crystallization

    • Optimized purification protocols may require extensive testing

  • Protein Stability:

    • Long-term stability at concentrations needed for crystallization (typically 5-20 mg/mL)

    • Identification of buffer conditions that prevent aggregation or precipitation

    • Temperature sensitivity during crystallization setup and crystal growth

  • Surface Properties:

    • Flexible regions or disordered domains may hinder crystal formation

    • Surface entropy reduction (SER) mutations might be necessary

    • Construct optimization to remove flexible termini

  • Crystallization Conditions:

    • Systematic screening of thousands of conditions may be required

    • Optimization of hits through fine gradient screens

    • Specialized techniques like seeding or phase diagram analysis

  • Post-Crystallization Handling:

    • Crystal cryoprotection for synchrotron data collection

    • Optimization of diffraction quality

    • Phase determination challenges for a novel protein structure

Researchers should consider parallel approaches such as NMR for smaller domains or cryo-EM for larger assemblies if crystallization proves particularly challenging.

How can researchers address contradictory findings in IIV3-004R functional studies?

When faced with contradictory results in IIV3-004R research, a systematic troubleshooting approach is recommended:

  • Experimental Variables Assessment:

    • Compare protein preparation methods (expression systems, tags, purification protocols)

    • Evaluate buffer compositions and storage conditions

    • Assess protein quality control metrics (purity, stability, activity assays)

  • Methodological Considerations:

    • Analyze differences in experimental techniques

    • Evaluate sensitivity and specificity of detection methods

    • Consider cell type or model system variations

  • Statistical Analysis:

    • Review statistical methods and sample sizes

    • Perform meta-analysis of available data when possible

    • Consider variability introduced by experimental conditions

  • Collaborative Verification:

    • Establish collaborative studies between laboratories reporting contradictory results

    • Standardize protocols and share reagents

    • Perform blinded studies to minimize bias

  • Orthogonal Approaches:

    • Implement multiple, independent methodologies to test hypotheses

    • Verify findings across different model systems

    • Design experiments that can distinguish between competing hypotheses

A structured approach to resolving contradictions not only clarifies the current understanding of IIV3-004R but also advances the field by establishing more robust experimental frameworks.

What emerging technologies could advance our understanding of IIV3-004R function?

Several cutting-edge technologies offer promising avenues for elucidating IIV3-004R function:

  • AlphaFold2 and RoseTTAFold:

    • Apply AI-based protein structure prediction to generate high-confidence structural models

    • Use predicted structures to guide hypothesis generation and experimental design

    • Combine with molecular dynamics simulations to explore conformational dynamics

  • Single-Cell Proteomics:

    • Analyze effects of IIV3-004R expression on cellular proteome at single-cell resolution

    • Identify cell-to-cell variability in response to the protein

    • Discover rare but significant cellular responses

  • Cryo-Electron Tomography:

    • Visualize IIV3-004R in its native viral context

    • Determine spatial organization within virions

    • Identify structural relationships with other viral components

  • Native Mass Spectrometry:

    • Analyze intact protein complexes involving IIV3-004R

    • Determine stoichiometry and binding interactions

    • Identify post-translational modifications

  • Time-Resolved Structural Methods:

    • Implement time-resolved X-ray crystallography or cryo-EM

    • Capture dynamic structural changes during protein function

    • Elucidate mechanistic details of interactions

  • Spatial Transcriptomics and Proteomics:

    • Map spatial distribution of IIV3-004R during infection

    • Correlate with host response patterns

    • Identify tissue-specific interactions

Integration of these advanced technologies with established methods will likely accelerate our understanding of this uncharacterized viral protein.

How can systems biology approaches enhance our understanding of IIV3-004R in the viral life cycle?

Systems biology offers powerful frameworks for understanding IIV3-004R in the broader context of viral infection:

  • Multi-Omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data from infection models

    • Identify pathways and networks affected by IIV3-004R

    • Construct predictive models of protein function within the viral life cycle

  • Network Analysis:

    • Map IIV3-004R interactions within virus-host protein interaction networks

    • Identify key nodes and potential functional modules

    • Predict systemic effects of IIV3-004R perturbation

  • Mathematical Modeling:

    • Develop quantitative models of viral replication incorporating IIV3-004R

    • Simulate effects of protein modifications or inhibition

    • Test model predictions experimentally

  • Comparative Virology:

    • Analyze functional conservation across related viral proteins

    • Identify essential vs. adaptable features

    • Infer evolutionary constraints and selective pressures

  • Host-Range Determinants:

    • Investigate IIV3-004R role in host specificity

    • Compare effects in permissive vs. non-permissive cells

    • Identify host factors that interact differentially across species

These approaches provide a holistic understanding of IIV3-004R beyond isolated biochemical or structural characterization, revealing its role in the complex dynamics of viral infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.