Recombinant Invertebrate iridescent virus 3 Uncharacterized protein 037L (IIV3-037L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
IIV3-037L; Uncharacterized protein 037L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-253
Protein Length
full length protein
Species
Invertebrate iridescent virus 3 (IIV-3) (Mosquito iridescent virus)
Target Names
IIV3-037L
Target Protein Sequence
MNAATSGIQLNAQTLSQQPAMNTPLIHRSFRDDYTGLVSAGDGLYKRKLKVPSTTRCNKF KWCSIGWSIGALIIFLVYKLEKPHVQPTSNGNLSLIEPEKLVSESQLIQKILNATTPQTT TPEIPSSTEPQELVTEILNTTTPQTTTPEIPSSTEPQELVTEIPSSTEPQEEIFSIFKSP KPEEPGGINSIPQYEQESNNVEDEPPPNKPEEEEDHDNQPLEERHTVPILGDVIIRNKTI IIDGGNETIIIKP
Uniprot No.

Target Background

Database Links

KEGG: vg:4156347

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is IIV3-037L and which organism does it come from?

IIV3-037L is an uncharacterized protein derived from Invertebrate iridescent virus 3 (IIV-3), also known as Mosquito iridescent virus. It is a full-length protein consisting of 253 amino acids . IIV-3 belongs to the Iridoviridae family, which is classified into five genera. Phylogenetic analyses of conserved proteins indicate that IIV-3 is distantly related to other iridovirus genera, showing low levels of amino acid identity to homologous proteins in other iridoviruses .

What is currently known about the structure of IIV3-037L?

Limited structural information is available for IIV3-037L, as it remains largely uncharacterized. Current research has focused on expressing the recombinant full-length protein (amino acids 1-253) with a His-tag in E. coli expression systems . For researchers interested in structural studies, initial approaches would include secondary structure prediction, homology modeling (if possible), and experimental determination through X-ray crystallography or cryo-EM.

Is IIV3-037L unique to IIV-3 or are there homologs in other viruses?

Based on genomic analyses, IIV-3 contains 33 genes that lack homologues in other iridoviruses, though the search results don't specifically identify IIV3-037L as one of these unique genes . Many IIV-3 proteins show distinctly low levels of amino acid identity with other iridovirus homologues, reflecting their evolutionary divergence. Researchers investigating this question should conduct updated BLAST searches against viral databases to identify potential distant homologs.

What functional domains have been identified or predicted in IIV3-037L?

The search results don't provide specific information about functional domains in IIV3-037L. Unlike some other IIV-3 proteins such as IIV3-053L (which shows similarity to DNA-dependent RNA polymerase subunit 7), IIV3-044L (a putative serine/threonine protein kinase), and IIV3-080R (with similarity to poxvirus MutT-like proteins), functional predictions for IIV3-037L remain limited . Researchers should employ computational tools like InterPro, Pfam, and SMART for domain prediction and consider experimental approaches like deletion mutant analysis to identify functional regions.

How does the expression of IIV3-037L vary during different stages of viral infection?

The temporal expression pattern of IIV3-037L during infection cycles has not been explicitly documented in the provided search results. Researchers investigating this question would need to design time-course experiments using techniques such as RT-qPCR to measure transcript levels, or Western blotting with specific antibodies to track protein levels at different stages of infection. RNA-seq analysis of infected cells at various time points would provide comprehensive data on the virus's transcriptional program.

What are the protein-protein interactions of IIV3-037L within viral particles and host cells?

While the search results mention a section on interacting proteins for IIV3-037L, specific interaction partners are not provided . Researchers interested in protein-protein interactions should consider techniques such as:

  • Co-immunoprecipitation followed by mass spectrometry

  • Yeast two-hybrid screening

  • Proximity labeling methods (BioID or APEX)

  • Protein microarrays

These approaches would help identify both viral and host cell proteins that interact with IIV3-037L, potentially providing insights into its function.

What are the optimal conditions for expressing and purifying recombinant IIV3-037L?

Based on the available information, recombinant IIV3-037L has been successfully expressed in E. coli as a His-tagged protein . For researchers attempting protein expression and purification, the following methodology is recommended:

  • Clone the full-length sequence (amino acids 1-253) into a bacterial expression vector with an N-terminal or C-terminal His-tag

  • Transform into an E. coli expression strain (BL21(DE3) or similar)

  • Optimize expression conditions (temperature, IPTG concentration, induction time)

  • Lyse cells using appropriate buffer systems

  • Purify using nickel affinity chromatography

  • Consider additional purification steps (ion exchange, size exclusion) based on intended applications

Researchers should monitor protein solubility and consider expression as a fusion protein (MBP, GST, SUMO) if solubility issues arise.

How can functional assays be designed to characterize the role of IIV3-037L?

Without known functions for IIV3-037L, researchers should consider a systematic approach to functional characterization:

  • Bioinformatic prediction of potential functions based on weak sequence similarities

  • Subcellular localization studies using fluorescently tagged protein in insect cell lines

  • Knockout or knockdown studies using CRISPR-Cas9 or RNAi to assess effects on viral replication

  • Protein interaction networks to identify potential pathways

  • Testing for common viral protein functions:

    • Nucleic acid binding assays

    • Enzyme activity screens (kinase, nuclease, etc.)

    • Immunomodulatory effects in insect cell systems

Results from these assays would guide more specific functional investigations.

How should contradictory results in IIV3-037L functional studies be reconciled?

When encountering contradictory results in functional studies of IIV3-037L, researchers should:

  • Examine methodological differences between studies (expression systems, tags, assay conditions)

  • Consider context-dependent functions (cell type, infection stage)

  • Verify protein folding and post-translational modifications

  • Reproduce experiments using standardized protocols

  • Employ multiple complementary techniques to validate findings

  • Collaborate with research groups reporting different results

Publication of negative results and methodological details is crucial for advancing understanding of this uncharacterized protein.

What bioinformatic tools are most appropriate for analyzing IIV3-037L evolutionary conservation?

For evolutionary analysis of IIV3-037L, researchers should utilize:

  • Multiple sequence alignment tools (MUSCLE, CLUSTAL Omega)

  • Phylogenetic analysis software (MEGA, PhyML, MrBayes)

  • Selection pressure analysis to identify conserved functional regions (PAML)

  • Structure-based alignments if structural data becomes available

  • Genome context analysis comparing gene neighborhood across related viruses

These approaches can help position IIV3-037L within the evolutionary history of iridoviruses and potentially identify distant relationships not apparent from sequence-based searches alone.

What expression systems and recombinant forms of IIV3-037L are available for research?

Currently, recombinant IIV3-037L is available as a His-tagged protein expressed in E. coli systems, covering the full protein length of 253 amino acids . The table below summarizes the recombinant form documented in the search results:

Catalog #Product NameSource (Host)SpeciesTagProtein Length
RFL23133IFRecombinant Full Length Invertebrate Iridescent Virus 3 Uncharacterized Protein 037L(Iiv3-037L) ProteinE.coliInvertebrate iridescent virus 3 (IIV-3) (Mosquito iridescent virus)HisFull Length (1-253)

Researchers may need to develop additional expression constructs for specific applications, such as:

  • Expression in insect cell lines for proper post-translational modifications

  • Fusion proteins with various tags (GST, MBP) for improved solubility

  • Truncated constructs to isolate specific domains once identified

How does IIV3-037L compare to similar proteins in other iridoviruses?

The genome of IIV-3 shows significant divergence from other iridoviruses, with low levels of amino acid identity in homologous proteins and a lack of obvious colinearity with any sequenced iridovirus . While 33 IIV-3 genes lack homologues in other iridoviruses, the search results don't specifically identify IIV3-037L as one of these unique genes.

Comparative analysis of IIV3-037L with proteins from other iridoviruses would require:

  • PSI-BLAST searches to identify distant homologs

  • Structural comparison if structures are available

  • Functional comparison if functions have been determined

  • Analysis of conservation patterns across virus families

What are the most promising approaches for determining the function of IIV3-037L?

Given the uncharacterized nature of IIV3-037L, researchers should consider multipronged approaches:

  • CRISPR-based knockout studies to assess essentiality for viral replication

  • Proteomics approaches to identify interaction partners

  • Structural determination through X-ray crystallography or cryo-EM

  • Transcriptomic analysis of host response to recombinant protein expression

  • In vitro biochemical assays testing common enzymatic functions

  • High-throughput screening approaches to identify potential inhibitors

Integration of these approaches would provide complementary data to build a functional profile of IIV3-037L.

How might advances in structural biology techniques impact our understanding of IIV3-037L?

Emerging structural biology techniques offer new opportunities for characterizing IIV3-037L:

  • AlphaFold2 and other AI-based structure prediction methods may provide initial structural models

  • Cryo-EM advances enable structure determination of smaller proteins and complexes

  • Hydrogen-deuterium exchange mass spectrometry can map protein interaction surfaces

  • Integrative structural biology approaches combining multiple experimental datasets

  • Time-resolved structural methods to capture conformational changes

These techniques could reveal structural features not apparent from sequence analysis alone, potentially providing functional insights for this uncharacterized protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.