Recombinant Invertebrate iridescent virus 3 Uncharacterized protein 073R (IIV3-073R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
IIV3-073R; Uncharacterized protein 073R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Invertebrate iridescent virus 3 (IIV-3) (Mosquito iridescent virus)
Target Names
IIV3-073R
Target Protein Sequence
MDNAPKTFKVDRHKQLVPLNPGLETNFVCSFEIKSLDGKPFQTTIVEQGQIKPTQYREVD DGFISGQLEGDGTPRSYFLVLRAQEPCECTVKIVLSPKQQVQPHQQTHQQSQQTHNKTVA NSGDPPPPPPSQPNKFLKPKWIVGMVIGVVVLYLLYRYRAQLMDKLNLGSKTPFSKN
Uniprot No.

Target Background

Database Links

KEGG: vg:4156284

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is Invertebrate iridescent virus 3 (IIV3) and how does it relate to other iridoviruses?

    Invertebrate iridescent virus 3 (IIV3), also known as mosquito iridescent virus, is currently the sole member of the genus Chloriridovirus within the Iridoviridae family. The Iridoviridae family is classified into five genera: Iridovirus and Chloriridovirus (which infect invertebrates), and Ranavirus, Lymphocystivirus, and Megalocytivirus (which infect vertebrates) .

    IIV3 possesses distinctive characteristics compared to other iridoviruses:

    • Virion size: 180 nm in diameter with icosahedral symmetry (T=189-217)

    • Genome: Linear dsDNA of approximately 190 kbp, with 20% being repetitive DNA

    • Unlike members of Ranavirus, Lymphocystivirus, and Megalocytivirus, IIV3's genome is not highly methylated

    Phylogenetic analyses indicate that IIV3 is distantly related to other iridovirus genera, with low levels of amino acid identity of predicted proteins to homologues in other iridoviruses, and a lack of obvious colinearity with any sequenced iridovirus .

  • What is known about the genomic organization of IIV3 and the 073R protein?

    The IIV3 genome is approximately 190 kbp in length, with about 20% consisting of repetitive DNA localized in 15 apparently noncoding regions. The genome encodes for 126 predicted proteins .

    The 073R protein is one of the uncharacterized proteins encoded by IIV3. While specific information about 073R is limited in the literature, it is categorized as "uncharacterized," indicating that its function has not been fully elucidated .

    Of the 126 predicted genes in IIV3:

    • 27 have homologues in all currently sequenced iridoviruses (potentially forming a genetic core for Iridoviridae)

    • 52 are present in IIV-6 but not in vertebrate iridoviruses

    • 33 lack homologues in other iridoviruses

    The genome contains terminal and redundant sequences and is circularly permuted, which is a characteristic feature of iridoviruses .

  • How is the replication cycle of IIV3 characterized?

    IIV3, like other members of Chloriridovirus, follows a nucleo-cytoplasmic replication pattern:

    1. Entry: Attachment of viral proteins to host receptors mediates endocytosis into the host cell

    2. Release of viral core: Fusion with the plasma membrane releases the DNA core into the host cytoplasm

    3. Nuclear phase: Viral DNA is transported to the cell nucleus where host macromolecular synthesis is rapidly shut down. Transcription is initiated by virally modified host RNA polymerase II

    4. DNA replication: Parental DNA is used to produce genome and greater than genome length DNA

    5. Cytoplasmic phase: Progeny DNA is transported into cytoplasmic viral factories where large concatemers of viral DNA are formed by recombination. Late transcription may occur in the cytoplasm

    6. Assembly: Assembly of new virions takes place in the cytoplasm

    7. Exit: Virions exit the cell either by budding or cell lysis

    The virus encodes several enzymes essential for replication, including DNA-directed DNA polymerase, DNA-directed RNA polymerase, and cysteine protease .

  • What expression systems are available for recombinant production of viral proteins like IIV3-073R?

    Based on the available information, several expression systems can be used for the recombinant production of viral proteins like IIV3-073R:

    Expression SystemAdvantagesChallenges
    E. coliRapid growth, high yield, cost-effectiveMay form inclusion bodies, limited post-translational modifications
    YeastEukaryotic processing, moderate yieldSome complex modifications may differ from insects
    BaculovirusInsect cell expression, suitable for virus proteinsMore complex setup, longer production time
    Mammalian cellsMost complete post-translational modificationsExpensive, lower yields, longer production time

    Commercial providers offer IIV3-073R produced in various systems, including E. coli, yeast, baculovirus, and mammalian cells . The choice of expression system should be based on the specific research requirements, particularly considering the need for proper folding and post-translational modifications that may be critical for functional studies .

Advanced Research Questions

  • What experimental design principles should be considered when studying uncharacterized viral proteins like IIV3-073R?

    When designing experiments to characterize novel viral proteins like IIV3-073R, several key principles should be considered:

    1. Randomization: Ensures unbiased assignment of treatments to experimental units, critical for controlling unknown variables when working with uncharacterized proteins

    2. Replication: Essential for estimating experimental error and increasing the precision of results. For protein characterization, this means technical replicates (same protein sample tested multiple times) and biological replicates (independently prepared protein samples)

    3. Local control: Designing experiments to account for heterogeneity of experimental material. For viral proteins, this might involve blocking based on protein preparation batches or experimental conditions

    4. Appropriate experimental unit selection: The experimental unit is the entity randomly assigned to a treatment. For protein studies, this could be protein preparations, cell cultures, or model organisms depending on the level of analysis

    5. Factorial design consideration: When investigating multiple factors affecting protein function (e.g., temperature, pH, cofactors), factorial designs allow examination of interaction effects

    Specific to uncharacterized viral proteins like IIV3-073R, experimental design should include:

    • Comparative approaches: Alignment with characterized proteins from related viruses

    • Domain analysis: Identification of conserved motifs that might suggest function

    • Systematic mutation studies: Creation of deletion or point mutation variants to identify functional regions

    • Interaction studies: Identification of binding partners (viral or host) through techniques like co-immunoprecipitation or yeast two-hybrid assays

  • How can researchers address confounding factors when studying recombinant viral protein function?

    When studying recombinant viral protein function, researchers must address various confounding factors that can influence experimental outcomes:

    1. Expression system effects: Different expression systems can introduce confounding variables through heterologous post-translational modifications or folding differences. This can be addressed through:

      • Using multiple expression systems for comparative analysis

      • Including appropriate controls expressed in the same system

      • Verification of protein structure and modifications

    2. Statistical approaches for handling confounding:

      • Instrumental variable (IV) analysis: Useful when certain variables cannot be directly controlled. This method uses a variable that is associated with the treatment but not directly with the outcome

      • Prior event rate ratio (PERR) method: Can adjust for measured and unmeasured confounding factors when baseline data is available

      • Matching cohorts: On relevant variables to control for heterogeneity in experimental conditions

    3. Experimental controls for confounding:

      • Negative controls: Testing structurally similar but functionally distinct proteins

      • Dose-response relationships: Establishing whether effects scale with protein concentration

      • Time-course analyses: Distinguishing immediate from secondary effects

      • Site-directed mutagenesis: Creating specific mutations to verify functional domains

    It's important to recognize that standard regression methods that only adjust for measured confounding factors may be insufficient when important variables cannot be observed or measured accurately .

  • What methodological approaches can be employed to determine the function of uncharacterized viral proteins like IIV3-073R?

    Determining the function of uncharacterized viral proteins requires a multi-faceted approach:

    1. Bioinformatic analysis:

      • Sequence homology searches against characterized proteins

      • Structural prediction using tools like AlphaFold2

      • Motif scanning for functional domains

      • Phylogenetic analysis to identify evolutionary relationships

    2. Protein-protein interaction studies:

      • Co-immunoprecipitation to identify binding partners

      • Yeast two-hybrid screening

      • Proximity labeling techniques (BioID, APEX)

      • Mass spectrometry-based interactome analysis

    3. Functional genomics approaches:

      • Gene knockout or knockdown in viral genome (if reverse genetics system available)

      • Complementation assays

      • Heterologous expression followed by phenotypic analysis

    4. Structural biology methods:

      • X-ray crystallography

      • Cryo-electron microscopy

      • Nuclear magnetic resonance (NMR) spectroscopy

      • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    5. Cell biology approaches:

      • Subcellular localization studies

      • Cell-based functional assays

      • Viral infection studies with mutant viruses

    A practical workflow might involve:

    1. Initial bioinformatic characterization

    2. Expression and purification of recombinant protein

    3. Structural studies to guide hypothesis generation

    4. Generation of interaction data

    5. Targeted functional assays based on predicted functions

    6. Validation in viral infection context if possible

  • How might RNAi techniques be applied to study IIV3-073R function in insect systems?

    RNA interference (RNAi) provides powerful tools for studying viral protein function in insect systems. For investigating IIV3-073R, the following approaches could be employed:

    1. RNAi knockdown in host cells:

      • Design small interfering RNAs (siRNAs) targeting IIV3-073R transcripts

      • Transfect insect cells (e.g., mosquito cell lines) with siRNAs prior to viral infection

      • Analyze changes in viral replication, virion production, and host responses

    2. Transgenic RNAi in model insects:

      • Generate transgenic Drosophila expressing hairpin RNAs targeting IIV3-073R

      • Challenge with IIV3 infection and assess viral replication kinetics

      • Examine tissue-specific effects through controlled expression of RNAi constructs

    3. Analysis of RNAi suppressor activity:

      • Test whether IIV3-073R functions as a viral suppressor of RNAi (VSR)

      • Employ reporter systems to measure RNAi efficiency in the presence/absence of IIV3-073R

      • Compare with known viral RNAi suppressors

    Experimental considerations:

    • DNA viruses like IIV6 have been shown to be targets of the Drosophila RNAi machinery, suggesting similar mechanisms might apply to IIV3

    • The efficacy of RNAi approaches can be assessed by measuring viral titers through quantitative RT-PCR as demonstrated in studies with Nora virus

    • Control experiments should include non-targeting siRNAs and comparison with knockdown of essential viral genes with known functions

    One caveat to consider is that if IIV3-073R itself has RNAi suppressor activity, alternative approaches such as CRISPR-based methods might be necessary to fully elucidate its function.

  • What challenges exist in expressing and purifying recombinant viral proteins like IIV3-073R, and how can they be overcome?

    Expressing and purifying recombinant viral proteins presents several challenges that require specific strategies to overcome:

    1. Expression challenges:

      • Protein hydrophobicity: Highly hydrophobic regions may cause aggregation

        • Solution: Use fusion tags that enhance solubility (MBP, SUMO, TRX)

        • Solution: Express truncated constructs excluding problematic domains

      • Codon usage bias: Viral codons may be rare in expression hosts

        • Solution: Codon optimization for the expression system

        • Solution: Use specialized strains with rare tRNAs

      • Protein toxicity: Viral proteins may be toxic to expression hosts

        • Solution: Use tightly controlled inducible expression systems

        • Solution: Lower expression temperature and inducer concentration

    2. Purification challenges:

      • Truncated products: Proteolysis or improper translation initiation

        • Solution: Use fusion tags at both N- and C-termini

        • Solution: Optimize elution conditions (e.g., increasing imidazole concentration)

      • Proper folding: Ensuring native-like structure

        • Solution: Co-expression with chaperones

        • Solution: Refolding protocols if expressed in inclusion bodies

      • Post-translational modifications: May be required for function

        • Solution: Select appropriate eukaryotic expression system

        • Solution: In vitro modification where applicable

    3. Specific challenges for IIV3-073R:
      This uncharacterized protein may have unique properties requiring specialized approaches:

      • If membrane-associated, consider detergent screening or membrane mimetics

      • If part of virus-host protein complexes, co-expression with interacting partners may improve stability

      • If containing important structural motifs, ensure expression constructs maintain these features

    Data from commercial expressions of IIV3-073R indicate successful production in multiple systems (E. coli, yeast, baculovirus, and mammalian cells), suggesting that expression is feasible but may require optimization for research-scale functional studies .

  • What are the potential functional predictions for IIV3-073R based on comparative genomics with other iridoviruses?

    While IIV3-073R remains uncharacterized, comparative genomics can provide insights into its potential functions:

    1. Core vs. unique genes analysis:
      The IIV3 genome contains 27 genes with homologues in all sequenced iridoviruses (core genes), 52 genes shared only with invertebrate iridoviruses like IIV6, and 33 genes unique to IIV3 . Determining which category IIV3-073R falls into would provide functional clues:

      • Core genes typically serve fundamental roles in replication

      • Genes shared with IIV6 may function in virus-invertebrate host interactions

      • Unique genes may confer specific adaptation to mosquito hosts

    2. Functional prediction by association:
      Among the characterized unique proteins in IIV3 are:

      • IIV3-053L: Shows similarity to DNA-dependent RNA polymerase subunit 7

      • IIV3-044L: A putative serine/threonine protein kinase

      • IIV3-080R: Shows similarity to poxvirus MutT-like proteins

      Analyzing whether IIV3-073R shows any structural or genomic proximity to these characterized proteins could suggest functional relationships.

    3. Structural motif analysis:
      Studies on Nora virus proteins have shown that structural motifs like leucine zippers and coiled-coil domains can be critical for viral functions . Similar motif analysis of IIV3-073R could reveal:

      • DNA/RNA binding domains suggesting roles in replication or transcription

      • Transmembrane domains indicating membrane association

      • Coiled-coil regions potentially involved in protein-protein interactions

      For example, the VP3 protein of Nora virus contains a coiled-coil domain essential for virion stability , and similar structural features in IIV3-073R might suggest roles in virion structure or stability.

    4. Functional testing methodology:
      Based on approaches used for other uncharacterized viral proteins, functional prediction for IIV3-073R could be validated through:

      • Generation of recombinant IIV3 with mutations in the 073R gene

      • Analysis of mutant virus phenotypes (replication kinetics, virion formation)

      • Testing viral fitness in different host systems

      • Biochemical assays guided by structural predictions

    The challenge with IIV3-073R is that it lacks obvious homologues in other viruses, requiring more creative approaches to functional prediction based on structural features and genomic context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.