Invertebrate iridescent virus 3 (IIV-3), also known as mosquito iridescent virus, is the sole member of the genus Chloriridovirus within the family Iridoviridae . Iridoviruses are large, icosahedral, double-stranded DNA viruses that cause infections ranging from subclinical to lethal in invertebrates and poikilothermic vertebrates . The IIV-3 genome has been fully sequenced and analyzed, revealing a complex genetic structure with 126 predicted genes . Among these genes is IIV3-112R, which encodes an uncharacterized protein of 112 amino acids in length . Despite being classified as "uncharacterized," recombinant versions of this protein have been produced for research purposes, allowing for investigations into its structure, properties, and potential functions .
This comprehensive review aims to compile and analyze available information on the Recombinant Invertebrate iridescent virus 3 Uncharacterized protein 112R (IIV3-112R), highlighting both current knowledge and gaps in understanding. By examining the protein's structural characteristics, production methods, physicochemical properties, and genomic context, this review serves as a resource for researchers interested in viral proteins and the biology of invertebrate iridescent viruses.
The IIV3-112R protein consists of 112 amino acids with a complete sequence as follows:
MGRQVTPIYPRTNGTIQPVNFPIRNMEPPNHSLQSAGFQIPPPDAQFPRYHAAAPHHPRVEAAAPSCLDVARHVESCPICSRIHDTDKTLYVLVIVGLTILCFLLVKRILKL
This sequence represents the full-length protein encoded by the IIV3-112R gene in the Invertebrate iridescent virus 3 genome . Notably, the protein contains a cysteine-rich region (CPIC) that may be involved in metal ion coordination or disulfide bond formation, though the specific structural implications of this feature have not been fully elucidated in the available literature . The C-terminal portion contains a predominantly hydrophobic region (LVIVGLTILCFLLVKRILKL), suggesting a possible membrane-associated function, though this remains speculative without further experimental confirmation .
Recombinant IIV3-112R has been successfully produced using different expression systems, primarily Escherichia coli and yeast-based platforms . The E. coli expression system appears to be the most commonly used method for producing the recombinant protein, likely due to its efficiency and cost-effectiveness . In these expression systems, the full-length sequence (amino acids 1-112) is typically used, often fused to an N-terminal His-tag to facilitate purification . The expression in different host organisms provides flexibility for researchers requiring the protein for various applications, as each system offers distinct advantages in terms of post-translational modifications, solubility, and yield.
Table 1: Expression Systems for Recombinant IIV3-112R Production
*Tag type determined during manufacturing process
The purification of recombinant IIV3-112R typically leverages affinity chromatography, taking advantage of the His-tag or other fusion tags incorporated into the recombinant construct . While specific purification protocols are not detailed in the search results, standard methods for His-tagged proteins typically involve immobilized metal affinity chromatography (IMAC), followed by additional purification steps such as size exclusion or ion exchange chromatography if higher purity is required . The reported purity levels range from greater than 85% to greater than 90% as determined by SDS-PAGE analysis, indicating effective purification processes .
For lyophilized recombinant IIV3-112R, a specific reconstitution protocol is recommended to ensure optimal protein stability and activity . The vial containing the lyophilized protein should be briefly centrifuged prior to opening to bring the contents to the bottom. The protein should then be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Addition of glycerol to a final concentration of 5-50% is recommended for long-term storage of the reconstituted protein, with a typical default glycerol concentration of 50% . After reconstitution, the protein solution should be aliquoted to minimize freeze-thaw cycles and stored at -20°C or -80°C for long-term use .
Invertebrate iridescent virus 3 possesses a complex genome of approximately 190 kbp, of which about 20% consists of repetitive DNA located in 15 apparently noncoding regions . The genome encodes 126 predicted genes, including IIV3-112R . Within the Iridoviridae family, 27 genes are conserved across all sequenced iridoviruses, forming a genetic core for the family, though it is not specified in the search results whether IIV3-112R is among these core genes .
Phylogenetic analysis of iridoviruses indicates that IIV-3 is distantly related to other iridovirus genera . While IIV-3 is more closely related to IIV-9 than to IIV-6 (Chilo iridescent virus, the prototype species of the genus Iridovirus), there is still significant evolutionary distance between them . This phylogenetic positioning is supported by the absence of obvious colinearity with any sequenced iridovirus, the low levels of amino acid identity of predicted proteins to iridovirus homologues, and comprehensive phylogenetic analyses of conserved proteins .
Of the 126 predicted IIV-3 genes, 33 lack homologues in other iridoviruses . While the search results do not specifically state whether IIV3-112R is among these unique genes, its designation as "uncharacterized" suggests limited homology to well-characterized proteins in other viruses or organisms . This uniqueness potentially reflects the distinct evolutionary history of the Chloriridovirus genus and may indicate specialized functions related to the virus's interaction with its invertebrate hosts.
Despite its commercial availability as a recombinant protein, the specific biological function of IIV3-112R remains largely unknown, as reflected by its designation as an "uncharacterized protein" . The search results do not provide experimental evidence regarding its role in viral replication, host interaction, or virion structure. The lack of functional characterization represents a significant gap in our understanding of this protein and the biology of IIV-3 more broadly.
Some structural features of the protein, such as the cysteine-rich region and hydrophobic C-terminus, suggest potential roles in protein-protein interactions, nucleic acid binding, or membrane association, but these remain speculative without functional studies . Proteomic analyses of IIV-9, a related iridovirus, have identified numerous proteins in the virus particle and infected cells, but the search results do not specifically mention whether IIV3-112R or its homologues were among the proteins identified .
The characterization of IIV3-112R faces several challenges that have likely contributed to its current uncharacterized status. First, invertebrate iridoviruses are less extensively studied compared to vertebrate viruses of medical or economic importance, resulting in fewer resources dedicated to understanding their specific proteins . Second, the lack of obvious homology to well-characterized proteins makes it difficult to infer function based on sequence similarity . Third, functional studies of viral proteins often require specialized assays and model systems, which may not be readily available for invertebrate iridoviruses .
Despite these limitations, the availability of recombinant IIV3-112R provides opportunities for researchers to conduct functional studies, including protein-protein interaction assays, localization studies, and structural analyses that could shed light on its role in the viral life cycle .
Recombinant IIV3-112R, available from commercial sources, serves as a valuable research tool for investigations into the biology of invertebrate iridoviruses . While specific applications are not detailed in the search results, the protein could potentially be used in various research contexts, including:
Immunological studies: As an antigen for generating antibodies against IIV-3, which could be used for detection, localization, or functional studies .
Structural biology: As a target for crystallographic or spectroscopic analyses to determine three-dimensional structure and potential functional domains .
Protein-protein interaction studies: To identify binding partners that could provide insights into its biological function .
Enzymatic assays: To test for potential enzymatic activities, although no specific enzymatic function has been attributed to IIV3-112R in the available literature .
The availability of the protein in both His-tagged and other tagged forms provides flexibility for different experimental approaches . Additionally, the ability to express the protein in different systems (E. coli and yeast) offers options for researchers requiring specific post-translational modifications or solubility characteristics .
Given the limited current understanding of IIV3-112R, numerous avenues for future research could significantly advance our knowledge of this protein and its role in viral biology. Priority areas for investigation include:
Functional characterization: Determining the biological function of IIV3-112R through targeted assays, including gene knockout or knockdown studies, complementation experiments, and localization analyses .
Structural determination: Resolving the three-dimensional structure of IIV3-112R using X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy to gain insights into potential functional domains .
Protein interaction network: Identifying proteins that interact with IIV3-112R, both viral and host, to place it within the context of virus-host interactions .
Evolutionary analysis: Conducting comparative genomic and phylogenetic analyses to understand the evolutionary history of IIV3-112R and identify potential homologues in other viruses or organisms .
Expression patterns: Investigating the temporal expression of IIV3-112R during viral infection to determine its role in the viral life cycle .
These research directions would not only enhance our understanding of IIV3-112R specifically but could also contribute to broader knowledge about invertebrate iridoviruses and their interactions with host organisms.
KEGG: vg:4156323
Recombinant Invertebrate Iridescent Virus 3 Uncharacterized Protein 112R (IIV3-112R) is a protein of currently unknown function derived from Invertebrate iridescent virus 3, also known as Mosquito iridescent virus. The recombinant form is typically expressed in expression systems such as E. coli with affinity tags (such as His-tag) to facilitate purification and downstream applications. The full-length protein consists of 112 amino acids, and its function remains to be fully characterized .
Unlike well-characterized proteins, IIV3-112R represents one of many uncharacterized viral proteins whose functions require structural and functional investigation. Current research approaches typically involve recombinant protein expression followed by structural and functional assays to determine its role in viral biology.
For optimal expression of functional IIV3-112R, E. coli is the most commonly used system as evidenced by commercially available recombinant forms of the protein . The bacterial expression system offers advantages including:
High yield production of the 112-amino acid protein
Compatibility with His-tag purification systems
Cost-effectiveness for initial characterization studies
For experimental protocols using E. coli:
BL21(DE3) strains typically provide good expression levels
Induction with IPTG at 0.5-1.0 mM when culture reaches OD600 of 0.6-0.8
Expression at lower temperatures (16-25°C) may enhance solubility
Lysis under native conditions with phosphate buffers containing imidazole
For researchers requiring potential post-translational modifications or studying protein-protein interactions, alternative expression systems to consider include:
| Expression System | Advantages | Limitations |
|---|---|---|
| Insect cells (Sf9, Sf21) | Native host-like environment, potential PTMs | Higher cost, longer production time |
| Yeast (P. pastoris) | Eukaryotic PTMs, secretion capability | Different glycosylation patterns |
| Mammalian cells | Most native-like PTMs and folding | Highest cost, lower yields |
When working with the recombinant protein, researchers should validate proper folding using circular dichroism or limited proteolysis assays regardless of the expression system used.
Determining the function of uncharacterized proteins like IIV3-112R requires a multi-faceted approach combining computational predictions with experimental validation:
Computational approaches:
Sequence homology analysis with known protein families
Structure prediction using AlphaFold2 or RoseTTAFold
Binding site prediction based on conserved motifs
Molecular dynamics simulations to predict potential ligand interactions
The computational approach demonstrated by Konc et al. for uncharacterized proteins provides an excellent methodological framework that could be applied to IIV3-112R. Their structure-based function prediction compares predicted binding sites to libraries of candidate structures, identifying potential functional similarities .
Experimental validation approaches:
Protein-protein interaction studies:
Yeast two-hybrid screening against host proteome
Co-immunoprecipitation followed by mass spectrometry
Proximity labeling (BioID/APEX) in relevant cell systems
Functional assays:
Viral replication assays with and without the protein
Gene knockout/knockdown studies in viral context
Host cell response measurements (transcriptomics, proteomics)
Biochemical characterization:
Enzymatic activity assays based on predicted function
Nucleic acid binding assays (EMSA, filter binding)
Structural studies (X-ray crystallography, cryo-EM)
For uncharacterized viral proteins, combining these approaches with the methodology demonstrated in the Tm1631 protein characterization case can reveal unexpected functional properties through binding site similarity assessment .
Structure-based function prediction represents a powerful approach for uncharacterized proteins like IIV3-112R when sequence homology fails to identify functional relationships. The methodology can be implemented as follows:
The approach used by Konc et al. with the Tm1631 protein demonstrates the power of this method. Their comparison of predicted binding sites against a library of structures revealed similarities with nucleotide binding sites, specifically DNA-binding sites of endonuclease IV, leading to functional prediction that was then validated through modeling and molecular dynamics .
For IIV3-112R, this approach could identify unexpected functional relationships even when sequence analysis provides limited insights. Validation of computational predictions through biochemical assays remains essential for confirming function.
Crystallizing uncharacterized viral proteins like IIV3-112R presents several unique challenges requiring specialized approaches:
Primary challenges:
Protein stability and solubility issues:
Many viral proteins have evolved to function in specific host environments
Recombinant expression may yield improperly folded or aggregation-prone proteins
Solution: Screen multiple buffer conditions with thermal shift assays (DSF) to identify stabilizing conditions
Conformational heterogeneity:
Viral proteins often adopt multiple conformations for function
Dynamic regions can hinder crystal lattice formation
Solution: Consider limited proteolysis to remove flexible regions or use surface entropy reduction
Post-translational modifications:
Expression in bacterial systems lacks eukaryotic PTMs
Missing PTMs may affect folding or stability
Solution: Consider insect cell expression systems when bacterial expression fails
Methodological approaches:
For crystallization screening of IIV3-112R, consider:
When working with the 112-amino acid IIV3-112R protein, its relatively small size offers advantages for crystallization but may present challenges for obtaining sufficient phase information. Consider selenomethionine labeling for experimental phasing if molecular replacement isn't feasible.
Protein-protein interaction (PPI) studies are crucial for understanding the functional role of uncharacterized proteins like IIV3-112R. Optimizing these studies requires consideration of multiple complementary approaches:
Affinity purification-mass spectrometry (AP-MS):
Optimized bait design:
Express IIV3-112R with different tags (FLAG, HA, His) to minimize tag interference
Include both N- and C-terminal tagged constructs to prevent blocking interaction surfaces
Consider native purification from viral-infected cells when possible
Control strategies:
Implement SILAC or TMT labeling for quantitative comparison
Use tag-only controls and unrelated viral protein controls
Include RNase/DNase treatment to eliminate nucleic acid-mediated interactions
Crosslinking strategies:
Optimize formaldehyde or DSS crosslinking to capture transient interactions
Consider photo-crosslinking for site-specific interaction analysis
Proximity-based approaches:
BioID or TurboID:
Express IIV3-112R fused to biotin ligase in relevant host cells
Optimize expression levels to minimize artifacts
Compare proximity profiles between infected and uninfected cells
APEX2 proximity labeling:
Shorter labeling window (1 minute) captures more dynamic interactions
Combine with subcellular fractionation to identify compartment-specific partners
Validation and functional characterization:
Reciprocal pulldowns:
Confirm key interactions using reversed bait-prey configuration
Quantify binding affinities using surface plasmon resonance or biolayer interferometry
Interaction mapping:
Create domain deletion constructs to map interaction regions
Use alanine scanning mutagenesis for critical residues
Perform competitive binding assays to identify mutually exclusive interactions
Functional validation:
Assess effects of disrupting interactions on viral replication
Measure changes in cellular localization when interactions are disrupted
Determine effects on downstream signaling pathways
For uncharacterized proteins like IIV3-112R, combining multiple orthogonal interaction detection methods provides higher confidence in identifying true interacting partners versus false positives. While no specific interacting partners for IIV3-112R have been documented in the available literature , these methodological approaches provide a robust framework for characterizing its interactome.
When facing contradictory experimental results regarding IIV3-112R function, researchers should employ a systematic approach to identify sources of discrepancy and reconcile findings:
1. Methodological variance analysis:
Protein preparation differences:
Compare expression systems used (bacterial vs. eukaryotic)
Analyze protein purification methods and purity assessments
Examine storage conditions and their impact on protein stability
Assay condition discrepancies:
Create a detailed table of buffer compositions, pH, and salt concentrations
Compare reaction temperatures and incubation times
Assess differences in detection methods and their sensitivity
Experimental design variations:
Analyze positive and negative controls used
Compare sample sizes and statistical approaches
Evaluate blinding and randomization protocols
2. Integrative data analysis approaches:
Meta-analysis techniques:
Perform weighted analysis based on methodological rigor
Apply Bayesian integration of conflicting datasets
Use machine learning to identify patterns across contradictory results
Orthogonal validation:
Design experiments that test the function through entirely different approaches
Validate in multiple cell lines or model systems
Implement CRISPR knockout studies to confirm specificity
3. Context-dependent function reconciliation:
For viral proteins like IIV3-112R, apparent contradictions may reflect genuine biological complexity:
Host-specific effects:
Test function in various host cell types
Examine dependency on host factors that may vary between systems
Concentration-dependent effects:
Perform dose-response curves at physiologically relevant concentrations
Consider stoichiometric relationships with interaction partners
Temporal dynamics:
Investigate function at different stages of viral infection
Consider post-translational modifications that may vary with infection progression
4. Collaborative resolution approaches:
When contradictions persist across research groups:
Organize inter-laboratory validation studies with standardized protocols
Establish material sharing agreements to eliminate reagent variability
Conduct blind parallel testing in multiple laboratories
When applying structure-based function prediction approaches as described for uncharacterized proteins , contradictions may arise between computational predictions and experimental results. In such cases, iterative refinement of structural models based on experimental feedback can help reconcile discrepancies.
For uncharacterized proteins like IIV3-112R, bioinformatic approaches offer valuable insights into potential functions. The following methodologies provide complementary perspectives:
1. Sequence-based analyses:
Remote homology detection:
Position-Specific Iterative BLAST (PSI-BLAST) to detect distant relationships
Hidden Markov Model profiles using HMMER
Profile-profile comparisons with HHpred
Motif and domain prediction:
InterProScan integration of multiple domain databases
Conservation analysis across viral families
Disorder prediction to identify flexible regions
Evolutionary analysis:
Phylogenetic profiling across viral species
Co-evolution analysis to identify functional partners
Selection pressure analysis (dN/dS ratios) to identify functionally important residues
2. Structure-based approaches:
Ab initio structure prediction:
AlphaFold2 or RoseTTAFold modeling
Model quality assessment using MolProbity
Structural similarity searches:
Molecular dynamics simulations:
Conformational sampling to identify functional states
Solvent and ion interaction analysis
Binding site flexibility assessment
3. Integrated prediction frameworks:
Function prediction pipelines:
COFACTOR for integrated structure and sequence-based function annotation
DeepFRI for deep learning-based function prediction
ProFunc for comprehensive function prediction
Data integration approaches:
Weighted prediction confidence scores
Consensus methods across multiple predictors
Network-based functional inference
The approach described by Konc et al. for uncharacterized proteins demonstrates how structure-based methods can reveal non-obvious functional relationships. Their success in identifying DNA binding activity in the Tm1631 protein by comparing predicted binding sites to a library of known structures illustrates the power of this approach . For IIV3-112R, similar methodology could identify functional properties not detectable through sequence analysis alone.
| Prediction Approach | Strength | Limitation | When to Use |
|---|---|---|---|
| Remote homology | Identifies distant relationships | May miss novel functions | First-line approach |
| Structure prediction | Reveals functional sites | Depends on model quality | When sequence analysis fails |
| Binding site comparison | Identifies functional analogs | Requires accurate site prediction | For detailed functional hypotheses |
| Molecular dynamics | Shows functional mechanics | Computationally intensive | For mechanism investigation |
Successful function prediction for uncharacterized proteins often requires integration of multiple bioinformatic approaches, with experimental validation of the resulting hypotheses.
As an uncharacterized viral protein, IIV3-112R has several potential research applications that extend beyond understanding its native function:
1. Model system for structural biology methodologies:
Novel structure determination approaches:
Test emerging crystallization techniques for challenging proteins
Develop optimized protocols for membrane-associated viral proteins
Evaluate new computational structure prediction algorithms
Protein engineering platform:
Stability engineering through rational design
Expression optimization case studies
Solubility enhancement strategies
2. Immunological research applications:
Antigen design and presentation studies:
Investigation of viral epitope processing
Development of diagnostic antibodies
Vaccine design methodology research
Host-pathogen interaction models:
Study innate immune recognition of viral proteins
Analyze adaptive immune responses to novel viral antigens
Investigate immune evasion mechanisms
3. Biotechnology applications:
Protein production system development:
Optimization of recombinant expression strategies
Tag configuration comparison studies
Purification protocol refinement
Biosensor development:
Novel detection platforms for viral proteins
Environmental monitoring applications
Rapid diagnostic development methodologies
The methodological approaches used in recombinant vaccine development, such as those documented for RIV3, provide valuable insights into production and safety assessment of recombinant viral proteins . While RIV3 represents a different application context, the underlying methodologies for expression, purification, and characterization have transferable principles for IIV3-112R research.
For research applications requiring high-quality recombinant IIV3-112R, commercially available preparations with His-tag purification systems enable consistent starting material for experimental investigations .
CRISPR/Cas systems offer powerful tools for investigating viral protein functions like IIV3-112R through precise genome editing approaches:
1. Direct viral genome editing:
Knockout studies:
Design guide RNAs targeting the IIV3-112R gene in the viral genome
Generate deletion mutants with precise boundaries
Create point mutations to disrupt specific domains while maintaining expression
Reporter system integration:
Insert fluorescent or luminescent tags for tracking viral protein localization
Create fusion proteins for real-time monitoring of expression
Develop split reporter systems to detect protein-protein interactions
Delivery considerations:
Package Cas9 and gRNAs in viral vectors or liposomes
Optimize timing of editing relative to viral infection
Implement inducible Cas9 systems for temporal control
2. Host cell engineering for interaction studies:
Host factor identification:
Conduct genome-wide CRISPR screens to identify essential host factors
Create knockout cell lines of candidate interaction partners
Generate cell lines with tagged versions of potential host interactors
Mechanistic investigations:
Engineer reporter cell lines responsive to viral protein activity
Create cellular biosensors for viral protein localization
Develop split protein complementation systems for interaction validation
3. Advanced CRISPR applications:
Base editing approaches:
Use cytidine or adenine base editors for precise amino acid substitutions
Apply prime editing for complex sequence alterations
Implement multiplexed editing to study combinatorial effects
Epigenetic modulation:
Employ CRISPRi to repress viral gene expression
Utilize CRISPRa to enhance expression for overexpression studies
Apply dCas9-based recruitment of chromatin modifiers to viral genomes
Spatiotemporal control:
Implement optogenetic Cas systems for light-controlled editing
Utilize chemically inducible systems for temporal control
Apply tissue-specific promoters in in vivo models
Experimental design considerations:
When designing CRISPR experiments for IIV3-112R functional studies:
Include comprehensive controls:
Non-targeting gRNAs
Editing of non-essential viral genes
Rescue experiments with complementing expression
Validation strategies:
Confirm editing efficiency through sequencing
Verify protein expression changes through Western blotting
Assess phenotypic effects using multiple orthogonal assays
Data analysis approaches:
Implement time-course analysis for temporal effects
Quantify viral replication through multiple methodologies
Apply systems biology approaches to understand network effects
The methodological framework used for studying uncharacterized proteins, as demonstrated with the Tm1631 protein , can be integrated with CRISPR approaches to generate and test hypotheses about IIV3-112R function through precise genetic manipulation.