Recombinant Invertebrate iridescent virus 3 Uncharacterized protein 112R (IIV3-112R)

Shipped with Ice Packs
In Stock

Description

Introduction

Invertebrate iridescent virus 3 (IIV-3), also known as mosquito iridescent virus, is the sole member of the genus Chloriridovirus within the family Iridoviridae . Iridoviruses are large, icosahedral, double-stranded DNA viruses that cause infections ranging from subclinical to lethal in invertebrates and poikilothermic vertebrates . The IIV-3 genome has been fully sequenced and analyzed, revealing a complex genetic structure with 126 predicted genes . Among these genes is IIV3-112R, which encodes an uncharacterized protein of 112 amino acids in length . Despite being classified as "uncharacterized," recombinant versions of this protein have been produced for research purposes, allowing for investigations into its structure, properties, and potential functions .

This comprehensive review aims to compile and analyze available information on the Recombinant Invertebrate iridescent virus 3 Uncharacterized protein 112R (IIV3-112R), highlighting both current knowledge and gaps in understanding. By examining the protein's structural characteristics, production methods, physicochemical properties, and genomic context, this review serves as a resource for researchers interested in viral proteins and the biology of invertebrate iridescent viruses.

Amino Acid Sequence and Protein Features

The IIV3-112R protein consists of 112 amino acids with a complete sequence as follows:

MGRQVTPIYPRTNGTIQPVNFPIRNMEPPNHSLQSAGFQIPPPDAQFPRYHAAAPHHPRVEAAAPSCLDVARHVESCPICSRIHDTDKTLYVLVIVGLTILCFLLVKRILKL

This sequence represents the full-length protein encoded by the IIV3-112R gene in the Invertebrate iridescent virus 3 genome . Notably, the protein contains a cysteine-rich region (CPIC) that may be involved in metal ion coordination or disulfide bond formation, though the specific structural implications of this feature have not been fully elucidated in the available literature . The C-terminal portion contains a predominantly hydrophobic region (LVIVGLTILCFLLVKRILKL), suggesting a possible membrane-associated function, though this remains speculative without further experimental confirmation .

Expression Systems

Recombinant IIV3-112R has been successfully produced using different expression systems, primarily Escherichia coli and yeast-based platforms . The E. coli expression system appears to be the most commonly used method for producing the recombinant protein, likely due to its efficiency and cost-effectiveness . In these expression systems, the full-length sequence (amino acids 1-112) is typically used, often fused to an N-terminal His-tag to facilitate purification . The expression in different host organisms provides flexibility for researchers requiring the protein for various applications, as each system offers distinct advantages in terms of post-translational modifications, solubility, and yield.

Table 1: Expression Systems for Recombinant IIV3-112R Production

Expression SystemTagProtein LengthProduct FormPuritySource Reference
E. coliHisFull Length (1-112)Lyophilized powder>90% (SDS-PAGE)
E. coliVariable*PartialNot specified>85% (SDS-PAGE)
YeastVariable*PartialNot specified>85% (SDS-PAGE)

*Tag type determined during manufacturing process

Purification Methods

The purification of recombinant IIV3-112R typically leverages affinity chromatography, taking advantage of the His-tag or other fusion tags incorporated into the recombinant construct . While specific purification protocols are not detailed in the search results, standard methods for His-tagged proteins typically involve immobilized metal affinity chromatography (IMAC), followed by additional purification steps such as size exclusion or ion exchange chromatography if higher purity is required . The reported purity levels range from greater than 85% to greater than 90% as determined by SDS-PAGE analysis, indicating effective purification processes .

Reconstitution Protocol

For lyophilized recombinant IIV3-112R, a specific reconstitution protocol is recommended to ensure optimal protein stability and activity . The vial containing the lyophilized protein should be briefly centrifuged prior to opening to bring the contents to the bottom. The protein should then be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Addition of glycerol to a final concentration of 5-50% is recommended for long-term storage of the reconstituted protein, with a typical default glycerol concentration of 50% . After reconstitution, the protein solution should be aliquoted to minimize freeze-thaw cycles and stored at -20°C or -80°C for long-term use .

The IIV-3 Genome

Invertebrate iridescent virus 3 possesses a complex genome of approximately 190 kbp, of which about 20% consists of repetitive DNA located in 15 apparently noncoding regions . The genome encodes 126 predicted genes, including IIV3-112R . Within the Iridoviridae family, 27 genes are conserved across all sequenced iridoviruses, forming a genetic core for the family, though it is not specified in the search results whether IIV3-112R is among these core genes .

Evolutionary Relationships

Phylogenetic analysis of iridoviruses indicates that IIV-3 is distantly related to other iridovirus genera . While IIV-3 is more closely related to IIV-9 than to IIV-6 (Chilo iridescent virus, the prototype species of the genus Iridovirus), there is still significant evolutionary distance between them . This phylogenetic positioning is supported by the absence of obvious colinearity with any sequenced iridovirus, the low levels of amino acid identity of predicted proteins to iridovirus homologues, and comprehensive phylogenetic analyses of conserved proteins .

Of the 126 predicted IIV-3 genes, 33 lack homologues in other iridoviruses . While the search results do not specifically state whether IIV3-112R is among these unique genes, its designation as "uncharacterized" suggests limited homology to well-characterized proteins in other viruses or organisms . This uniqueness potentially reflects the distinct evolutionary history of the Chloriridovirus genus and may indicate specialized functions related to the virus's interaction with its invertebrate hosts.

Current Understanding

Despite its commercial availability as a recombinant protein, the specific biological function of IIV3-112R remains largely unknown, as reflected by its designation as an "uncharacterized protein" . The search results do not provide experimental evidence regarding its role in viral replication, host interaction, or virion structure. The lack of functional characterization represents a significant gap in our understanding of this protein and the biology of IIV-3 more broadly.

Some structural features of the protein, such as the cysteine-rich region and hydrophobic C-terminus, suggest potential roles in protein-protein interactions, nucleic acid binding, or membrane association, but these remain speculative without functional studies . Proteomic analyses of IIV-9, a related iridovirus, have identified numerous proteins in the virus particle and infected cells, but the search results do not specifically mention whether IIV3-112R or its homologues were among the proteins identified .

Research Limitations

The characterization of IIV3-112R faces several challenges that have likely contributed to its current uncharacterized status. First, invertebrate iridoviruses are less extensively studied compared to vertebrate viruses of medical or economic importance, resulting in fewer resources dedicated to understanding their specific proteins . Second, the lack of obvious homology to well-characterized proteins makes it difficult to infer function based on sequence similarity . Third, functional studies of viral proteins often require specialized assays and model systems, which may not be readily available for invertebrate iridoviruses .

Despite these limitations, the availability of recombinant IIV3-112R provides opportunities for researchers to conduct functional studies, including protein-protein interaction assays, localization studies, and structural analyses that could shed light on its role in the viral life cycle .

Applications in Research

Recombinant IIV3-112R, available from commercial sources, serves as a valuable research tool for investigations into the biology of invertebrate iridoviruses . While specific applications are not detailed in the search results, the protein could potentially be used in various research contexts, including:

  1. Immunological studies: As an antigen for generating antibodies against IIV-3, which could be used for detection, localization, or functional studies .

  2. Structural biology: As a target for crystallographic or spectroscopic analyses to determine three-dimensional structure and potential functional domains .

  3. Protein-protein interaction studies: To identify binding partners that could provide insights into its biological function .

  4. Enzymatic assays: To test for potential enzymatic activities, although no specific enzymatic function has been attributed to IIV3-112R in the available literature .

The availability of the protein in both His-tagged and other tagged forms provides flexibility for different experimental approaches . Additionally, the ability to express the protein in different systems (E. coli and yeast) offers options for researchers requiring specific post-translational modifications or solubility characteristics .

Future Research Directions

Given the limited current understanding of IIV3-112R, numerous avenues for future research could significantly advance our knowledge of this protein and its role in viral biology. Priority areas for investigation include:

  1. Functional characterization: Determining the biological function of IIV3-112R through targeted assays, including gene knockout or knockdown studies, complementation experiments, and localization analyses .

  2. Structural determination: Resolving the three-dimensional structure of IIV3-112R using X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy to gain insights into potential functional domains .

  3. Protein interaction network: Identifying proteins that interact with IIV3-112R, both viral and host, to place it within the context of virus-host interactions .

  4. Evolutionary analysis: Conducting comparative genomic and phylogenetic analyses to understand the evolutionary history of IIV3-112R and identify potential homologues in other viruses or organisms .

  5. Expression patterns: Investigating the temporal expression of IIV3-112R during viral infection to determine its role in the viral life cycle .

These research directions would not only enhance our understanding of IIV3-112R specifically but could also contribute to broader knowledge about invertebrate iridoviruses and their interactions with host organisms.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement, and we will fulfill them to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
IIV3-112R; Uncharacterized protein 112R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-112
Protein Length
full length protein
Species
Invertebrate iridescent virus 3 (IIV-3) (Mosquito iridescent virus)
Target Names
IIV3-112R
Target Protein Sequence
MGRQVTPIYPRTNGTIQPVNFPIRNMEPPNHSLQSAGFQIPPPDAQFPRYHAAAPHHPRV EAAAPSCLDVARHVESCPICSRIHDTDKTLYVLVIVGLTILCFLLVKRILKL
Uniprot No.

Target Background

Database Links

KEGG: vg:4156323

Protein Families
IIV-6 466R family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Recombinant Invertebrate Iridescent Virus 3 Uncharacterized Protein 112R (IIV3-112R)?

Recombinant Invertebrate Iridescent Virus 3 Uncharacterized Protein 112R (IIV3-112R) is a protein of currently unknown function derived from Invertebrate iridescent virus 3, also known as Mosquito iridescent virus. The recombinant form is typically expressed in expression systems such as E. coli with affinity tags (such as His-tag) to facilitate purification and downstream applications. The full-length protein consists of 112 amino acids, and its function remains to be fully characterized .

Unlike well-characterized proteins, IIV3-112R represents one of many uncharacterized viral proteins whose functions require structural and functional investigation. Current research approaches typically involve recombinant protein expression followed by structural and functional assays to determine its role in viral biology.

What expression systems are optimal for producing functional IIV3-112R?

For optimal expression of functional IIV3-112R, E. coli is the most commonly used system as evidenced by commercially available recombinant forms of the protein . The bacterial expression system offers advantages including:

  • High yield production of the 112-amino acid protein

  • Compatibility with His-tag purification systems

  • Cost-effectiveness for initial characterization studies

For experimental protocols using E. coli:

  • BL21(DE3) strains typically provide good expression levels

  • Induction with IPTG at 0.5-1.0 mM when culture reaches OD600 of 0.6-0.8

  • Expression at lower temperatures (16-25°C) may enhance solubility

  • Lysis under native conditions with phosphate buffers containing imidazole

For researchers requiring potential post-translational modifications or studying protein-protein interactions, alternative expression systems to consider include:

Expression SystemAdvantagesLimitations
Insect cells (Sf9, Sf21)Native host-like environment, potential PTMsHigher cost, longer production time
Yeast (P. pastoris)Eukaryotic PTMs, secretion capabilityDifferent glycosylation patterns
Mammalian cellsMost native-like PTMs and foldingHighest cost, lower yields

When working with the recombinant protein, researchers should validate proper folding using circular dichroism or limited proteolysis assays regardless of the expression system used.

What experimental approaches can be used to determine the function of IIV3-112R?

Determining the function of uncharacterized proteins like IIV3-112R requires a multi-faceted approach combining computational predictions with experimental validation:

Computational approaches:

  • Sequence homology analysis with known protein families

  • Structure prediction using AlphaFold2 or RoseTTAFold

  • Binding site prediction based on conserved motifs

  • Molecular dynamics simulations to predict potential ligand interactions

The computational approach demonstrated by Konc et al. for uncharacterized proteins provides an excellent methodological framework that could be applied to IIV3-112R. Their structure-based function prediction compares predicted binding sites to libraries of candidate structures, identifying potential functional similarities .

Experimental validation approaches:

  • Protein-protein interaction studies:

    • Yeast two-hybrid screening against host proteome

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling (BioID/APEX) in relevant cell systems

  • Functional assays:

    • Viral replication assays with and without the protein

    • Gene knockout/knockdown studies in viral context

    • Host cell response measurements (transcriptomics, proteomics)

  • Biochemical characterization:

    • Enzymatic activity assays based on predicted function

    • Nucleic acid binding assays (EMSA, filter binding)

    • Structural studies (X-ray crystallography, cryo-EM)

For uncharacterized viral proteins, combining these approaches with the methodology demonstrated in the Tm1631 protein characterization case can reveal unexpected functional properties through binding site similarity assessment .

How can structure-based function prediction be applied to IIV3-112R?

Structure-based function prediction represents a powerful approach for uncharacterized proteins like IIV3-112R when sequence homology fails to identify functional relationships. The methodology can be implemented as follows:

The approach used by Konc et al. with the Tm1631 protein demonstrates the power of this method. Their comparison of predicted binding sites against a library of structures revealed similarities with nucleotide binding sites, specifically DNA-binding sites of endonuclease IV, leading to functional prediction that was then validated through modeling and molecular dynamics .

For IIV3-112R, this approach could identify unexpected functional relationships even when sequence analysis provides limited insights. Validation of computational predictions through biochemical assays remains essential for confirming function.

What are the challenges in crystallizing uncharacterized viral proteins like IIV3-112R?

Crystallizing uncharacterized viral proteins like IIV3-112R presents several unique challenges requiring specialized approaches:

Primary challenges:

  • Protein stability and solubility issues:

    • Many viral proteins have evolved to function in specific host environments

    • Recombinant expression may yield improperly folded or aggregation-prone proteins

    • Solution: Screen multiple buffer conditions with thermal shift assays (DSF) to identify stabilizing conditions

  • Conformational heterogeneity:

    • Viral proteins often adopt multiple conformations for function

    • Dynamic regions can hinder crystal lattice formation

    • Solution: Consider limited proteolysis to remove flexible regions or use surface entropy reduction

  • Post-translational modifications:

    • Expression in bacterial systems lacks eukaryotic PTMs

    • Missing PTMs may affect folding or stability

    • Solution: Consider insect cell expression systems when bacterial expression fails

Methodological approaches:

For crystallization screening of IIV3-112R, consider:

When working with the 112-amino acid IIV3-112R protein, its relatively small size offers advantages for crystallization but may present challenges for obtaining sufficient phase information. Consider selenomethionine labeling for experimental phasing if molecular replacement isn't feasible.

How can protein-protein interaction studies be optimized for characterizing IIV3-112R?

Protein-protein interaction (PPI) studies are crucial for understanding the functional role of uncharacterized proteins like IIV3-112R. Optimizing these studies requires consideration of multiple complementary approaches:

Affinity purification-mass spectrometry (AP-MS):

  • Optimized bait design:

    • Express IIV3-112R with different tags (FLAG, HA, His) to minimize tag interference

    • Include both N- and C-terminal tagged constructs to prevent blocking interaction surfaces

    • Consider native purification from viral-infected cells when possible

  • Control strategies:

    • Implement SILAC or TMT labeling for quantitative comparison

    • Use tag-only controls and unrelated viral protein controls

    • Include RNase/DNase treatment to eliminate nucleic acid-mediated interactions

  • Crosslinking strategies:

    • Optimize formaldehyde or DSS crosslinking to capture transient interactions

    • Consider photo-crosslinking for site-specific interaction analysis

Proximity-based approaches:

  • BioID or TurboID:

    • Express IIV3-112R fused to biotin ligase in relevant host cells

    • Optimize expression levels to minimize artifacts

    • Compare proximity profiles between infected and uninfected cells

  • APEX2 proximity labeling:

    • Shorter labeling window (1 minute) captures more dynamic interactions

    • Combine with subcellular fractionation to identify compartment-specific partners

Validation and functional characterization:

  • Reciprocal pulldowns:

    • Confirm key interactions using reversed bait-prey configuration

    • Quantify binding affinities using surface plasmon resonance or biolayer interferometry

  • Interaction mapping:

    • Create domain deletion constructs to map interaction regions

    • Use alanine scanning mutagenesis for critical residues

    • Perform competitive binding assays to identify mutually exclusive interactions

  • Functional validation:

    • Assess effects of disrupting interactions on viral replication

    • Measure changes in cellular localization when interactions are disrupted

    • Determine effects on downstream signaling pathways

For uncharacterized proteins like IIV3-112R, combining multiple orthogonal interaction detection methods provides higher confidence in identifying true interacting partners versus false positives. While no specific interacting partners for IIV3-112R have been documented in the available literature , these methodological approaches provide a robust framework for characterizing its interactome.

How can contradictory experimental results about IIV3-112R function be reconciled?

When facing contradictory experimental results regarding IIV3-112R function, researchers should employ a systematic approach to identify sources of discrepancy and reconcile findings:

1. Methodological variance analysis:

  • Protein preparation differences:

    • Compare expression systems used (bacterial vs. eukaryotic)

    • Analyze protein purification methods and purity assessments

    • Examine storage conditions and their impact on protein stability

  • Assay condition discrepancies:

    • Create a detailed table of buffer compositions, pH, and salt concentrations

    • Compare reaction temperatures and incubation times

    • Assess differences in detection methods and their sensitivity

  • Experimental design variations:

    • Analyze positive and negative controls used

    • Compare sample sizes and statistical approaches

    • Evaluate blinding and randomization protocols

2. Integrative data analysis approaches:

  • Meta-analysis techniques:

    • Perform weighted analysis based on methodological rigor

    • Apply Bayesian integration of conflicting datasets

    • Use machine learning to identify patterns across contradictory results

  • Orthogonal validation:

    • Design experiments that test the function through entirely different approaches

    • Validate in multiple cell lines or model systems

    • Implement CRISPR knockout studies to confirm specificity

3. Context-dependent function reconciliation:

For viral proteins like IIV3-112R, apparent contradictions may reflect genuine biological complexity:

  • Host-specific effects:

    • Test function in various host cell types

    • Examine dependency on host factors that may vary between systems

  • Concentration-dependent effects:

    • Perform dose-response curves at physiologically relevant concentrations

    • Consider stoichiometric relationships with interaction partners

  • Temporal dynamics:

    • Investigate function at different stages of viral infection

    • Consider post-translational modifications that may vary with infection progression

4. Collaborative resolution approaches:

When contradictions persist across research groups:

  • Organize inter-laboratory validation studies with standardized protocols

  • Establish material sharing agreements to eliminate reagent variability

  • Conduct blind parallel testing in multiple laboratories

When applying structure-based function prediction approaches as described for uncharacterized proteins , contradictions may arise between computational predictions and experimental results. In such cases, iterative refinement of structural models based on experimental feedback can help reconcile discrepancies.

What bioinformatic approaches are most valuable for predicting IIV3-112R function?

For uncharacterized proteins like IIV3-112R, bioinformatic approaches offer valuable insights into potential functions. The following methodologies provide complementary perspectives:

1. Sequence-based analyses:

  • Remote homology detection:

    • Position-Specific Iterative BLAST (PSI-BLAST) to detect distant relationships

    • Hidden Markov Model profiles using HMMER

    • Profile-profile comparisons with HHpred

  • Motif and domain prediction:

    • InterProScan integration of multiple domain databases

    • Conservation analysis across viral families

    • Disorder prediction to identify flexible regions

  • Evolutionary analysis:

    • Phylogenetic profiling across viral species

    • Co-evolution analysis to identify functional partners

    • Selection pressure analysis (dN/dS ratios) to identify functionally important residues

2. Structure-based approaches:

  • Ab initio structure prediction:

    • AlphaFold2 or RoseTTAFold modeling

    • Model quality assessment using MolProbity

  • Structural similarity searches:

    • DALI or TM-align for fold recognition

    • ProBiS for binding site similarity detection

    • CASTp for pocket identification and comparison

  • Molecular dynamics simulations:

    • Conformational sampling to identify functional states

    • Solvent and ion interaction analysis

    • Binding site flexibility assessment

3. Integrated prediction frameworks:

  • Function prediction pipelines:

    • COFACTOR for integrated structure and sequence-based function annotation

    • DeepFRI for deep learning-based function prediction

    • ProFunc for comprehensive function prediction

  • Data integration approaches:

    • Weighted prediction confidence scores

    • Consensus methods across multiple predictors

    • Network-based functional inference

The approach described by Konc et al. for uncharacterized proteins demonstrates how structure-based methods can reveal non-obvious functional relationships. Their success in identifying DNA binding activity in the Tm1631 protein by comparing predicted binding sites to a library of known structures illustrates the power of this approach . For IIV3-112R, similar methodology could identify functional properties not detectable through sequence analysis alone.

Prediction ApproachStrengthLimitationWhen to Use
Remote homologyIdentifies distant relationshipsMay miss novel functionsFirst-line approach
Structure predictionReveals functional sitesDepends on model qualityWhen sequence analysis fails
Binding site comparisonIdentifies functional analogsRequires accurate site predictionFor detailed functional hypotheses
Molecular dynamicsShows functional mechanicsComputationally intensiveFor mechanism investigation

Successful function prediction for uncharacterized proteins often requires integration of multiple bioinformatic approaches, with experimental validation of the resulting hypotheses.

What are potential applications of IIV3-112R in recombinant protein research?

As an uncharacterized viral protein, IIV3-112R has several potential research applications that extend beyond understanding its native function:

1. Model system for structural biology methodologies:

  • Novel structure determination approaches:

    • Test emerging crystallization techniques for challenging proteins

    • Develop optimized protocols for membrane-associated viral proteins

    • Evaluate new computational structure prediction algorithms

  • Protein engineering platform:

    • Stability engineering through rational design

    • Expression optimization case studies

    • Solubility enhancement strategies

2. Immunological research applications:

  • Antigen design and presentation studies:

    • Investigation of viral epitope processing

    • Development of diagnostic antibodies

    • Vaccine design methodology research

  • Host-pathogen interaction models:

    • Study innate immune recognition of viral proteins

    • Analyze adaptive immune responses to novel viral antigens

    • Investigate immune evasion mechanisms

3. Biotechnology applications:

  • Protein production system development:

    • Optimization of recombinant expression strategies

    • Tag configuration comparison studies

    • Purification protocol refinement

  • Biosensor development:

    • Novel detection platforms for viral proteins

    • Environmental monitoring applications

    • Rapid diagnostic development methodologies

The methodological approaches used in recombinant vaccine development, such as those documented for RIV3, provide valuable insights into production and safety assessment of recombinant viral proteins . While RIV3 represents a different application context, the underlying methodologies for expression, purification, and characterization have transferable principles for IIV3-112R research.

For research applications requiring high-quality recombinant IIV3-112R, commercially available preparations with His-tag purification systems enable consistent starting material for experimental investigations .

How can CRISPR/Cas systems be used to investigate the role of IIV3-112R in viral replication?

CRISPR/Cas systems offer powerful tools for investigating viral protein functions like IIV3-112R through precise genome editing approaches:

1. Direct viral genome editing:

  • Knockout studies:

    • Design guide RNAs targeting the IIV3-112R gene in the viral genome

    • Generate deletion mutants with precise boundaries

    • Create point mutations to disrupt specific domains while maintaining expression

  • Reporter system integration:

    • Insert fluorescent or luminescent tags for tracking viral protein localization

    • Create fusion proteins for real-time monitoring of expression

    • Develop split reporter systems to detect protein-protein interactions

  • Delivery considerations:

    • Package Cas9 and gRNAs in viral vectors or liposomes

    • Optimize timing of editing relative to viral infection

    • Implement inducible Cas9 systems for temporal control

2. Host cell engineering for interaction studies:

  • Host factor identification:

    • Conduct genome-wide CRISPR screens to identify essential host factors

    • Create knockout cell lines of candidate interaction partners

    • Generate cell lines with tagged versions of potential host interactors

  • Mechanistic investigations:

    • Engineer reporter cell lines responsive to viral protein activity

    • Create cellular biosensors for viral protein localization

    • Develop split protein complementation systems for interaction validation

3. Advanced CRISPR applications:

  • Base editing approaches:

    • Use cytidine or adenine base editors for precise amino acid substitutions

    • Apply prime editing for complex sequence alterations

    • Implement multiplexed editing to study combinatorial effects

  • Epigenetic modulation:

    • Employ CRISPRi to repress viral gene expression

    • Utilize CRISPRa to enhance expression for overexpression studies

    • Apply dCas9-based recruitment of chromatin modifiers to viral genomes

  • Spatiotemporal control:

    • Implement optogenetic Cas systems for light-controlled editing

    • Utilize chemically inducible systems for temporal control

    • Apply tissue-specific promoters in in vivo models

Experimental design considerations:

When designing CRISPR experiments for IIV3-112R functional studies:

  • Include comprehensive controls:

    • Non-targeting gRNAs

    • Editing of non-essential viral genes

    • Rescue experiments with complementing expression

  • Validation strategies:

    • Confirm editing efficiency through sequencing

    • Verify protein expression changes through Western blotting

    • Assess phenotypic effects using multiple orthogonal assays

  • Data analysis approaches:

    • Implement time-course analysis for temporal effects

    • Quantify viral replication through multiple methodologies

    • Apply systems biology approaches to understand network effects

The methodological framework used for studying uncharacterized proteins, as demonstrated with the Tm1631 protein , can be integrated with CRISPR approaches to generate and test hypotheses about IIV3-112R function through precise genetic manipulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.