Recombinant Invertebrate iridescent virus 3 Uncharacterized protein 126R (IIV3-126R)

Shipped with Ice Packs
In Stock

Description

Genomic Context and Evolutionary Significance

IIV3-126R is encoded by a unique gene in the IIV-3 genome, which lacks orthologues in other sequenced iridoviruses, including IIV-6 (Chilo iridescent virus) and vertebrate-associated genera (e.g., Ranavirus) . Key genomic insights include:

Genome Organization

  • Genome Size: ~190 kbp (IIV-3) vs. ~135 kbp (IIV-6) .

  • Repetitive Regions: ~20% of the IIV-3 genome is repetitive, with 15 noncoding regions .

  • Gene Distribution:

    • 27 core genes: Shared across all iridoviruses (e.g., DNA polymerase, helicase).

    • 52 invertebrate-specific genes: Present in IIV-3 and IIV-6 but absent in vertebrate iridoviruses (e.g., DNA topoisomerase II, serine/threonine kinase) .

    • 33 unique genes: Exclusive to IIV-3, including IIV3-126R .

Comparative Analysis

FeatureIIV-3IIV-6Vertebrate Iridoviruses
Genome Size190 kbp~135 kbp~150–200 kbp
Repetitive DNA~20%Not reportedRare
Unique Genes33 (IIV3-126R, IIV3-053L, etc.)N/AN/A
Host RangeInvertebratesInvertebratesVertebrates

IIV3-126R belongs to the invertebrate-specific gene cluster, suggesting a potential role in host interactions, replication, or immune evasion .

Functional Insights

  • Uncharacterized Role: No homologues in non-IIV3 iridoviruses or other viral families, indicating a novel function .

  • Potential Functions:

    • Viral Replication: May interact with host machinery during infection.

    • Host Adaptation: Could mediate interactions with mosquito or other invertebrate cells.

Experimental Models

Recombinant IIV3-126R is used in studies to:

  1. Probe Viral Pathways: Investigate protein-protein interactions or enzymatic activity.

  2. Develop Diagnostic Tools: Detect IIV-3 infections in invertebrate hosts.

Current Applications

  • Virology Research: Studying IIV-3 replication, host specificity, and evolutionary divergence .

  • Biotechnology: Serves as a reagent for antibody production or protein interaction assays .

Challenges

  • Limited Functional Data: No experimental evidence links IIV3-126R to specific biological processes.

  • Host Specificity: IIV-3 infects invertebrates, limiting cross-species functional studies.

References Creative BioMart. Recombinant Full Length Invertebrate Iridescent Virus 3 Uncharacterized Protein 126R(Iiv3-126R) Protein, His-Tagged. Delhon et al. (2006). Genome of invertebrate iridescent virus type 3 (mosquito iridescent virus). J Virol, 80(11), 5345–5351. Delhon et al. (2006). Genome of Invertebrate Iridescent Virus Type 3. PLOS Pathogens. ChemicalBook. Recombinant Invertebrate iridescent virus 3 Uncharacterized protein 126R (IIV3-126R). van Lent et al. (2014). Construction and Characterization of a Recombinant Invertebrate Iridovirus. Virus Res, 189, 286–292. Wong et al. (2011). Complete genome sequence of invertebrate iridescent virus 22. J Gen Virol, 92(1), 211–219.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We recommend storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
IIV3-126R; Uncharacterized protein 126R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Invertebrate iridescent virus 3 (IIV-3) (Mosquito iridescent virus)
Target Names
IIV3-126R
Target Protein Sequence
MSGDCIASLKMVESQPLNSKEVEYVEKLLDPFDPVDTVERFTHNPNDPISVPIDPALIWS RKAIMRLIGLVVVLIINFPKVRDKINLNPYLVWVITTLILMGVFY
Uniprot No.

Target Background

Database Links

KEGG: vg:4156337

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the phylogenetic relationship between IIV3-126R and other iridovirus proteins?

IIV3-126R is classified within the Iridoviridae family, which contains both vertebrate iridoviruses (VIVs) and invertebrate iridoviruses (IIVs). Phylogenetic analysis requires constructing sequence alignments using tools such as M-Coffee and identifying conserved blocks with GBlocks. Maximum likelihood, maximum parsimony, and distance matrix methods implemented in software like MEGA6 can establish evolutionary relationships between IIV3-126R and other iridovirus proteins . The most reliable approach is to perform concatenated protein alignments of core genes rather than single-gene phylogenies, as this produces more robust phylogenetic trees with higher bootstrap values.

What is the predicted protein structure and sequence of IIV3-126R?

While the specific sequence of IIV3-126R is not provided in the available data, we can infer its structure based on related iridovirus proteins. Similar to IIV3-071L, the complete sequence would likely be expressed in a baculovirus expression system and purified to >85% using SDS-PAGE verification . Standard protein prediction tools would identify domains, secondary structures, and potential functional motifs. The protein likely contains conserved regions shared across the Iridoviridae family, potentially including DNA-binding motifs, enzyme activity sites, or structural components based on orthologous clustering patterns observed in other iridovirus proteins .

How does IIV3-126R compare to the characterized IIV3-071L protein?

IIV3-071L is an uncharacterized protein consisting of 221 amino acids with the sequence beginning with MGLDNFTAPS and ending with KNMNLGKM . While both proteins come from the same virus (IIV-3), their functions may differ based on sequence conservation patterns. To properly compare these proteins, researchers should perform orthologous clustering analysis using different parameter settings (coverage and identity percentages) as demonstrated in DIV-1 and IIV-6 protein comparisons . Comparison metrics should include algebraic connectivity percentages and reciprocal BLAST hit analyses to establish homology relationships.

What are the optimal expression systems for producing functional recombinant IIV3-126R?

The preferred expression system for IIV3-126R would be baculovirus, as demonstrated with IIV3-071L . For optimal expression, the experimental design should include:

  • Gene synthesis with codon optimization for insect cell expression

  • Subcloning into a baculovirus transfer vector with appropriate tags (His-tag or GST-tag)

  • Transfection of Sf9 or Hi5 insect cells

  • Protein expression verification by western blot

  • Purification via affinity chromatography

Expression temperature, time, and MOI (multiplicity of infection) should be optimized through factorial design experiments. Common challenges include protein solubility and maintaining proper folding, which can be addressed through the addition of chaperones or modified buffer conditions during purification .

What methods are most effective for studying protein-protein interactions involving IIV3-126R?

To elucidate the function of this uncharacterized protein, researchers should employ multiple complementary approaches:

  • Yeast two-hybrid screening against host cell proteins

  • Co-immunoprecipitation followed by mass spectrometry

  • Proximity labeling techniques (BioID or APEX)

  • Surface plasmon resonance for kinetic measurements

  • Crosslinking mass spectrometry for structural interaction mapping

Analysis should focus on orthologous clustering to identify potential interaction partners based on proteins with similar connectivity patterns in the iridovirus pan-genome . The algebraic connectivity percentages observed in related proteins can guide hypothesis generation about potential interaction partners. For instance, proteins with high algebraic connectivity (>80%) often share functional relationships within viral systems .

How can CRISPR-Cas9 be utilized to study the function of IIV3-126R in host cells?

CRISPR-Cas9 methodology can be applied to study IIV3-126R through:

  • Viral genome editing to generate knockout mutants

  • Tagging the endogenous gene with fluorescent reporters

  • Creating cellular models with potential interacting host proteins knocked out

The experimental design should include careful gRNA selection to minimize off-target effects, appropriate controls including scrambled gRNAs, and phenotypic assays to measure viral replication efficiency, host cell responses, and virion production. Based on orthologous clustering patterns observed in related iridoviruses, researchers should prioritize examining interactions with proteins showing similar connectivity patterns to those identified in DIV-1 and IIV-6 comparative analyses .

How should researchers analyze orthologous clustering data for IIV3-126R?

Orthologous clustering analysis for IIV3-126R should follow established protocols for iridovirus protein comparison. Based on methodologies used for other iridovirus proteins, researchers should:

  • Perform reciprocal BLAST hits (RBH) using multiple parameter settings:

    • Coverage 30%, identity 30%, minimal connectivity 10%

    • Coverage 30%, identity 30%, minimal connectivity 5%

    • Coverage 20%, identity 20%, minimal connectivity 10%

    • Coverage 20%, identity 20%, minimal connectivity 5%

  • Calculate algebraic connectivity percentages to quantify the degree of similarity within orthologous clusters

  • Construct a table similar to those used for DIV-1 protein analysis:

Putative functionIIV-6 proteinsIIV3-126ROrthologous cluster a (alg. conn. in %)Orthologous cluster b (alg. conn. in %)Orthologous cluster c (alg. conn. in %)Orthologous cluster d (alg. conn. in %)
[Function][ID]IIV3-126R[Value][Value][Value][Value]

This approach allows for systematic comparison across different stringency settings to identify true orthologous relationships versus spurious matches .

What statistical approaches are appropriate for comparative genomic analysis of IIV3-126R?

For robust comparative genomic analysis of IIV3-126R, researchers should employ:

  • Bayesian phylogenetic methods (e.g., MrBayes) for evolutionary relationship inference

  • Maximum likelihood approaches for gene tree construction

  • Multiple sequence alignment quality assessment via M-Coffee

  • Conservative block selection using GBlocks to remove poorly aligned regions

Statistical significance should be established through bootstrap analysis (>1000 replicates) and posterior probability calculations. For orthologous relationship quantification, algebraic connectivity percentages provide a mathematical framework for determining relationship strength, with values ≥80% typically indicating strong conservation and functional similarity across viral species .

How can researchers differentiate between true orthology and functional convergence in IIV3-126R analysis?

Differentiating true orthology from functional convergence requires:

  • Establishing bi-directional best hits across multiple iridovirus genomes

  • Examining syntenic relationships (gene order conservation)

  • Comparing protein domain architecture beyond simple sequence similarity

  • Analyzing selective pressure through dN/dS ratios

Researchers should utilize the approach demonstrated in DIV-1 analysis where proteins were assigned to orthologous clusters through progressive stringency filtering . True orthologs typically maintain connectivity across multiple parameter settings, while functionally convergent proteins may only appear related under less stringent conditions. The table below illustrates a framework for such analysis:

Analysis approachTrue orthology indicatorsFunctional convergence indicators
Sequence similarityHigh similarity across full lengthSimilarity limited to functional domains
Synteny analysisConserved gene neighborhoodDifferent genomic contexts
Selection analysisSimilar selective constraintsDifferent evolutionary pressures
Connectivity metricsHigh algebraic connectivity (>80%)Low connectivity (<50%)

How does IIV3-126R compare to known functional proteins in IIV-6?

While specific data on IIV3-126R is limited, comparison to IIV-6 proteins should follow the methodology used in DIV-1 analysis:

  • Perform tBLASTn searches against reference sequences

  • Manually inspect clusters of orthologs in Iridoviridae

  • Conduct BLASTp searches against GenBank nr database

Based on patterns observed in other iridovirus comparisons, researchers should examine whether IIV3-126R shows similarity to any of the following functional IIV-6 proteins that have been identified in comparative analyses:

  • DNA polymerase family B (037L)

  • Major capsid protein (274L)

  • A32-like packaging ATPase (075L)

  • Helicase (022L)

  • Transcription factors and RNA polymerase components

The relationship would be quantified using algebraic connectivity percentages across multiple parameter settings to establish confidence in functional relationships.

What insights can be gained by comparing IIV3-126R to DIV-1 proteins?

Comparative analysis between IIV3-126R and DIV-1 proteins can reveal evolutionary relationships and potential functional conservation. Researchers should:

  • Identify potential DIV-1 homologs through reciprocal BLAST analysis

  • Construct multiple sequence alignments of candidate homologs

  • Generate phylogenetic trees to visualize relationships

  • Compare protein domain structures

What functional assays can determine if IIV3-126R has enzymatic activity?

To assess potential enzymatic activity of IIV3-126R, researchers should first analyze sequence similarity to known enzymatic proteins in iridoviruses, such as:

  • Ribonuclease 3

  • Helicase

  • Kinase

  • DNA polymerase

  • Thymidine kinase

Based on these predictions, functional assays should include:

  • Standard enzymatic activity assays with appropriate substrates

  • Substrate specificity determination

  • Kinetic parameter measurement (Km, Vmax, kcat)

  • Inhibition studies

  • Structure-function relationship analysis through mutation of predicted active sites

The recombinant protein expression and purification protocols would follow approaches similar to those used for IIV3-071L, with modifications based on the specific physicochemical properties of IIV3-126R .

What are the optimal storage conditions to maintain IIV3-126R stability?

Based on guidelines for similar recombinant viral proteins:

  • Long-term storage:

    • Liquid form: 6 months at -20°C/-80°C

    • Lyophilized form: 12 months at -20°C/-80°C

  • Working conditions:

    • Store working aliquots at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles

The stability is influenced by buffer composition, protein concentration, and the presence of stabilizing agents. For optimal results, researchers should aliquot the purified protein immediately after preparation and store at the recommended temperatures. Any specific buffer requirements would depend on the particular characteristics of IIV3-126R, which may be inferred from related iridovirus proteins.

What quality control methods should be applied to verify IIV3-126R integrity?

Quality control for recombinant IIV3-126R should include:

  • Purity assessment using SDS-PAGE (target >85% purity)

  • Western blot verification with appropriate antibodies

  • Mass spectrometry to confirm protein identity and mass

  • Circular dichroism to assess secondary structure

  • Dynamic light scattering to evaluate aggregation state

Functional assays specific to the predicted activity of IIV3-126R should also be developed as definitive quality control measures. For proteins with unknown function, baseline biophysical characterization becomes especially important for quality control purposes. Researchers should document batch-to-batch variations and establish acceptance criteria for each quality control parameter.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.