Recombinant Invertebrate iridescent virus 6 Probable cysteine proteinase 224L (IIV6-224L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
IIV6-224L; Probable cysteine proteinase 224L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-449
Protein Length
full length protein
Species
Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus)
Target Names
IIV6-224L
Target Protein Sequence
MKTKNRLLNSDIDFVNESIPYSRSDFNNMLTKLSSNDYYQLMVNTYIGTYGSAKFFGEST KTLPENFNWKTITEFDPPSIVSKKKLISEPENQYLCGNCWAMSTVQTIGDRFVVAGLVNW VPDLSTTFAMLYYPQGQCDGGNSAKLMRQIHTGIGLASKHCIDYSWCSRNIECKTDNSLG HFVSENKSYLLPSKKGCYYNSKHYIYKIDSRPKIISGYGTLNTDNEVLNNQILLKQEILA NGPAVGGFLVFENFTSAFTKVNGGVYLENVSNYGSGKPVEFNPHINKYSGNHVVSILGWG VAKGIKISNTQFSDVPYWFCRNTWGKNWGDKGYFKIAMYPFNKKSQFLKLVSIVDHEGHT RRNSGVVICNVSETPILQSLPVIPSTEIPKSLDNSTNFYSQDENYEIKNNSQNEKGFPKG NRRRTTSSDTQIVFIFFLSVVILFIFIIL
Uniprot No.

Target Background

Function
Probable cysteine protease.
Database Links

KEGG: vg:1733244

Protein Families
Peptidase C1 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the genomic location and basic structure of IIV6-224L within the IIV-6 genome?

IIV6-224L is encoded within the 212,482 bp double-stranded DNA genome of Invertebrate iridescent virus 6 (also known as Chilo iridescent virus). The virus genome encodes 211-215 putative open reading frames (ORFs) distributed along both strands . IIV6-224L is one of these ORFs and encodes a probable cysteine proteinase of 449 amino acids. The protein contains characteristic domains of cysteine proteases and appears to have enzymatic activity (EC 3.4.-.-).

How is the IIV6-224L gene regulated during viral infection?

Recent transcriptional analysis has categorized IIV-6 genes into three kinetic classes: immediate-early (IE), delayed-early (DE), and late (L) genes. According to comprehensive RT-PCR analysis of virus-infected insect cells, specific regulatory motifs control the expression of each class. For IIV6-224L, its expression pattern follows specific temporal regulation, and its promoter region contains characteristic motifs that influence its transcription timing during infection . Researchers studying this gene should consider its temporal expression pattern when designing experiments to analyze its function.

What are the optimal conditions for expressing recombinant IIV6-224L in bacterial systems?

For efficient expression of recombinant IIV6-224L in E. coli systems, researchers should consider the following protocol:

  • Vector Selection: Use expression vectors with strong inducible promoters (T7 or tac) and N-terminal His-tag for purification.

  • Expression Conditions:

    • Host strain: BL21(DE3) or Rosetta for potentially rare codons

    • Induction: 0.5-1.0 mM IPTG at OD₆₀₀ of 0.6-0.8

    • Temperature: Lower temperature (16-20°C) often yields better results for soluble protein

    • Duration: 16-18 hours for optimal yield

  • Purification Protocol:

    • Lysis in Tris/PBS-based buffer (pH 8.0) with protease inhibitors

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Consider adding 6% trehalose to storage buffer to enhance stability

For researchers concerned with protein solubility, fusion partners like MBP or SUMO may enhance soluble expression.

What methodologies are recommended for analyzing IIV6-224L enzymatic activity?

To assess the cysteine proteinase activity of IIV6-224L, researchers should employ multiple complementary approaches:

  • Fluorogenic Substrate Assay:

    • Use Z-FR-AMC (benzyloxycarbonyl-Phe-Arg-7-amido-4-methylcoumarin) as substrate

    • Measure hydrolysis at excitation/emission wavelengths of 380/460 nm

    • Include E-64 (standard cysteine protease inhibitor) as control

  • Gel-based Activity Assays:

    • Zymography using gelatin or casein as substrate

    • Analyze activity bands after SDS-PAGE under non-reducing conditions

  • pH and Temperature Profiling:

    • Test activity across pH range 4.0-9.0 and temperatures 20-50°C

    • Include DTT (1-5 mM) to maintain reduced state of active site cysteine

When interpreting results, researchers should account for potential autoproteolytic activity, which is common for viral cysteine proteases.

How can I validate the specificity of anti-IIV6-224L antibodies for immunological studies?

When validating antibodies against IIV6-224L for research applications, implement the following validation strategy:

  • Western Blot Analysis:

    • Test against purified recombinant protein and IIV-6 infected cell lysates

    • Include pre-immune serum and non-infected cells as negative controls

    • Expected band size: approximately 49-50 kDa (plus tag size if applicable)

  • Cross-Reactivity Assessment:

    • Test against related viral cysteine proteases, particularly from other iridoviruses

    • Analyze potential cross-reactivity with host cell proteases

  • Immunoprecipitation Validation:

    • Perform IP followed by mass spectrometry to confirm target specificity

    • Use siRNA knockdown in infected cells to validate signal reduction

  • Immunofluorescence Microscopy:

    • Compare subcellular localization patterns in infected versus non-infected cells

    • Validate with blocking peptides to confirm signal specificity

Which model systems are most appropriate for studying IIV6-224L function during viral infection?

Several model systems have been established for studying IIV-6 infection and the specific role of IIV6-224L:

  • Drosophila melanogaster:

    • Advantages: Well-characterized genetics, RNAi screening capabilities

    • Applications: Study host immune responses, viral replication dynamics

    • Key finding: IIV-6 establishes productive infection without high mortality in wild-type flies, but RNAi pathway mutants (Dcr-2, AGO2) show increased susceptibility

  • Insect Cell Lines:

    • S2* cells (Drosophila): Good for mechanistic studies of viral gene function

    • Other lepidopteran cell lines: For comparative host range studies

  • Cricket (Gryllus bimaculatus) Model:

    • Advantages: Natural host showing clinical symptoms

    • Applications: Virus transmission studies, pathogenesis research

  • Reptilian Models:

    • Several lizard species have been documented with IIV-6 infections

    • Useful for studying host-switching and cross-species transmission

The data from these models suggest differential roles of IIV6-224L in various hosts, with potential implication in host range determination and pathogenesis mechanisms.

How can I design experiments to analyze the role of IIV6-224L in the viral life cycle?

To elucidate the specific function of IIV6-224L in the viral life cycle, implement the following experimental approaches:

  • Temporal Expression Analysis:

    • RT-qPCR to determine expression kinetics during infection

    • Western blot analysis at different time points post-infection

    • Correlation with viral DNA replication and virion assembly phases

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation to identify viral or host protein partners

    • Yeast two-hybrid screening using IIV6-224L as bait

    • Proximity labeling approaches (BioID or APEX2) in infected cells

  • Genetic Approaches:

    • Generation of temperature-sensitive mutants or conditional knockouts

    • CRISPR interference in viral genome to downregulate expression

    • Complementation assays with mutated versions of the protein

  • Functional Inhibition Studies:

    • Treatment with specific cysteine protease inhibitors during infection

    • Analysis of effects on viral protein processing, replication, and assembly

    • Correlation with virus production and infectivity

A comprehensive approach combining these methods will provide insight into whether IIV6-224L functions in viral entry, replication, assembly, or host immune evasion.

What is the role of IIV6-224L in counteracting host immune responses in invertebrate systems?

Current evidence suggests that IIV6-224L may play a significant role in modulating host immune responses through several mechanisms:

  • Interaction with RNAi Machinery:

    • IIV-6 is targeted by the host RNAi machinery in Drosophila

    • Dcr-2 and AGO2 mutant flies show increased susceptibility to infection

    • IIV6-224L may cleave components of the RNAi pathway, though direct evidence is still emerging

  • JAK-STAT Pathway Modulation:

    • The JAK-STAT pathway is activated during IIV-6 infection in Drosophila

    • This leads to expression of Turandot proteins, which are stress response factors

    • IIV6-224L potentially cleaves components of this pathway to regulate immune activation

  • Inhibition of IMD and Toll Pathways:

    • IIV-6 infection blocks antimicrobial peptide responses triggered by IMD and Toll pathways

    • Evidence suggests the block occurs downstream of pathway activation

    • IIV6-224L may be one of several viral factors responsible for this inhibition

Researchers should design targeted experiments to determine if IIV6-224L directly cleaves specific immune components or affects their regulation through other mechanisms.

How do the structural features of IIV6-224L compare to other viral cysteine proteases, and what are the implications for inhibitor design?

Comparative structural analysis reveals both conserved and unique features of IIV6-224L relative to other viral cysteine proteases:

  • Conserved Catalytic Domain:

    • The CGNCWAM motif represents the catalytic core similar to papain-like proteases

    • Contains characteristic thiol group in the active site cysteine residue

    • Exhibits the canonical papain fold with separate domains creating a substrate-binding cleft

  • Unique Structural Elements:

    • Contains viral-specific insertion regions not found in cellular proteases

    • C-terminal transmembrane domain (final 23 amino acids) suggests membrane association

    • Substrate-binding pocket appears more hydrophobic than related proteases

  • Implications for Inhibitor Design:

    • The unique substrate-binding pocket suggests opportunity for specific inhibitors

    • Potential for allosteric inhibition targeting viral-specific insertions

    • Rational design should focus on the relatively accessible active site while accounting for the membrane-associated nature of the protein

Researchers should consider these structural features when designing inhibitors targeting IIV6-224L, potentially yielding tools to study IIV-6 replication and pathogenesis.

What are the evolutionary relationships between IIV6-224L and related proteins in other iridoviruses?

Phylogenetic analysis of IIV6-224L and homologous proteins in other iridoviruses reveals important evolutionary patterns:

  • Conservation Across Iridoviridae:

    • IIV6-224L shows moderate sequence conservation among members of the Iridovirus genus

    • Lower conservation when compared to vertebrate iridoviruses (Ranavirus, Lymphocystivirus)

    • Functional domains show higher conservation than non-catalytic regions

  • Evolutionary Divergence:

    • The genome organization of IIV-3 (Chloriridovirus) differs significantly from IIV-6, with no obvious colinearity

    • IIV-3 has 126 ORFs compared to 215 in IIV-6, with substantial divergence

    • This suggests independent evolution of proteolytic functions in different iridovirus lineages

  • Functional Conservation vs. Sequence Divergence:

    • Despite sequence divergence, catalytic residues remain conserved

    • Substrate specificity likely varies between viral species

    • These differences may contribute to host range determination and adaptation

This evolutionary context provides researchers with important frameworks for understanding the functional diversification of viral proteases within the Iridoviridae family.

What are the common challenges in purifying enzymatically active IIV6-224L, and how can they be addressed?

Researchers frequently encounter several challenges when purifying active IIV6-224L:

  • Limited Solubility:

    • Challenge: Tendency to form inclusion bodies in E. coli

    • Solution: Express at lower temperatures (16-18°C) with reduced inducer concentration

    • Alternative: Use solubility-enhancing tags (MBP, SUMO, TrxA) with appropriate cleavage sites

  • Autoproteolytic Activity:

    • Challenge: Self-cleavage during expression and purification

    • Solution: Include protease inhibitors specific for cysteine proteases (E-64, leupeptin)

    • Alternative: Create catalytically inactive mutants (C→S mutation at active site) for structural studies

  • Membrane Association:

    • Challenge: C-terminal transmembrane domain affects solubility and purification

    • Solution: Express truncated versions lacking the transmembrane domain

    • Alternative: Use detergent-based extraction (0.5-1% DDM or CHAPS)

  • Maintaining Enzymatic Activity:

    • Challenge: Loss of activity during purification and storage

    • Solution: Include reducing agents (1-5 mM DTT) in all buffers

    • Storage recommendation: Add 6% trehalose and store at -80°C in small aliquots to avoid freeze-thaw cycles

Implementation of these strategies significantly improves the yield and activity of purified IIV6-224L for functional and structural studies.

How can I optimize detection and quantification of IIV-6 infection in experimental systems?

Reliable detection and quantification of IIV-6 infection is crucial for experimental reproducibility:

  • Molecular Detection Methods:

    • qPCR targeting conserved viral genes (major capsid protein gene)

    • Use primers P1FOR and P2REV corresponding to IIV6 major capsid protein positions 25-52 and 892-917

    • PCR conditions: denature at 95°C for 10 min, then 94°C for 2 min, 41°C for 2 min

    • Include standardized plasmid controls for absolute quantification

  • Protein-Based Detection:

    • Western blot using antibodies against viral structural proteins

    • Flow cytometry for single-cell analysis of infection rates

    • Automated image analysis of immunofluorescence for high-throughput screening

  • Visualization Approaches:

    • Monitor iridescence in infected organisms (characteristic of advanced infection)

    • Light microscopy to detect paracrystalline arrays of virions

    • Electron microscopy for definitive identification of viral particles

  • Functional Assays:

    • Plaque assays using susceptible cell lines

    • TCID50 assays for quantitative assessment of infectious particles

    • Reporter virus systems (if available) for real-time monitoring

These methods provide complementary approaches for comprehensive characterization of IIV-6 infection in experimental systems.

What contradictions exist in the current literature regarding IIV6-224L function, and how might these be resolved experimentally?

Several contradictions and knowledge gaps exist in the literature regarding IIV6-224L function:

  • Substrate Specificity Contradictions:

    • Some studies suggest broad substrate specificity while others indicate higher selectivity

    • Resolution approach: Perform comparative proteomics on infected cells with and without protease inhibitors

    • Validation method: In vitro cleavage assays with candidate substrates identified from proteomics

  • Temporal Classification Inconsistencies:

    • Conflicting reports about whether IIV6-224L belongs to early or late gene classes

    • Resolution approach: Time-course analysis using RT-qPCR with and without DNA synthesis inhibitors

    • Validation: Reporter assays with the IIV6-224L promoter region to confirm temporal regulation

  • Subcellular Localization Discrepancies:

    • Uncertainty about membrane association versus cytoplasmic distribution

    • Resolution approach: Confocal microscopy with subcellular markers and GFP-tagged constructs

    • Validation: Biochemical fractionation combined with Western blot analysis

  • Host Range Determination Role:

    • Unclear contribution to the broad host range of IIV-6

    • Resolution approach: Compare activity against host proteins from permissive and non-permissive species

    • Validation: Generate viral mutants with altered IIV6-224L specificity and test host range

These experimental approaches would help resolve current contradictions and advance understanding of IIV6-224L's precise role in viral replication and host interactions.

What are the potential applications of IIV6-224L in biotechnology and as a research tool?

IIV6-224L presents several promising applications in biotechnology and as a research tool:

  • Protease-Based Biotechnology Applications:

    • Development of sequence-specific proteases for protein engineering

    • Construction of self-cleaving fusion protein systems

    • Design of biosensors for detecting specific protein substrates

  • Research Tools for Immunology:

    • Study mechanisms of viral immune evasion

    • Investigate protease-mediated modulation of host signaling pathways

    • Develop inhibitors as probes to study viral replication

  • Structural Biology Applications:

    • Model system for understanding viral cysteine protease mechanisms

    • Template for structure-based drug design targeting related viral proteases

    • Investigation of membrane-associated proteolytic complexes

  • Evolutionary Virology Studies:

    • Comparative analysis of protease evolution across diverse viral families

    • Understanding functional adaptation in viral proteases

    • Insight into host-pathogen coevolution mechanisms

Researchers should consider these potential applications when designing experiments with broader impacts beyond basic virology research.

How might advanced genomic and proteomic approaches enhance our understanding of IIV6-224L function?

Advanced omics technologies offer powerful approaches to elucidate IIV6-224L function:

  • CRISPR-Based Genomic Screens:

    • Genome-wide CRISPR screens to identify host factors required for IIV6-224L function

    • CRISPRi/CRISPRa approaches to modulate host response pathways

    • Base editing to introduce specific mutations in viral protease

  • Proteomic Analysis:

    • N-terminomics to identify protease cleavage sites in host and viral proteins

    • Proximity labeling (BioID, APEX) to map protein interaction networks

    • Phosphoproteomics to detect signaling changes induced by protease activity

  • Structural Genomics Approaches:

    • Cryo-EM analysis of IIV6-224L in complex with substrates

    • AlphaFold2 prediction of interactions with potential host targets

    • Molecular dynamics simulations of substrate recognition and catalysis

  • Integrative Multi-Omics:

    • Combined analysis of transcriptomics and proteomics during infection

    • Correlation of IIV6-224L expression with changes in host proteome

    • Systems biology approaches to model protease impact on host networks

These advanced approaches would provide comprehensive insights into the molecular function of IIV6-224L within the complex virus-host interaction landscape.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.