Recombinant Invertebrate iridescent virus 6 Probable cysteine proteinase 361L (IIV6-361L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
IIV6-361L; Probable cysteine proteinase 361L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-542
Protein Length
full length protein
Species
Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus)
Target Names
IIV6-361L
Target Protein Sequence
MTSIINQRWPLGNLMDGFPNGEKQNKLSFGGVPEKGYFEEFNKDPKYISFSGTPEKAYFE EFNRYRNIDEDDNRDTFPLFNEISSNPESESYLQTFVDNVRINTDINFVSKTNSFSQNDL SYLNATYVDKSLSLELPIKFNWAKTTSADSPDVVAKKKLISKPDNQYLCGSCWAVSVAGV VGDVFAVAGLVNWVPNISATYALIHYPQGRCKGGDPATLLYNIANNGIPSKHCVDYSWCS QNRTCTTADSAAHFGSDLSPLIPKDRGCYFDSEHYIFKIDSNIRTIVAGSGAIDVSNVQR TIKEYIYTTGPAVGGYIIFRNFTSKVPFGPHKGNSTFNVINGGVYLEKANYAQYRGEYGE HITEGLTFSSSNTDSDNYAGGHAISIMGWGIQPRIRVGNGPNDIADVPYWYCRNSWGTKW GMNGGYFKIAMYPYNRKSQFSKIVELMTPQGQHIRLGGVLAFTVSNPPVLKKLPANKQPP NPNSLSKLLDYYKNDEDDIVTKLPNIVPPSDGKKSTTSKTNNWYIYALIIIFILIIFFVL RK
Uniprot No.

Target Background

Function

Probable cysteine protease.

Database Links

KEGG: vg:1733399

Protein Families
Peptidase C1 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is IIV6-361L and what is its fundamental structure?

IIV6-361L is a probable cysteine proteinase encoded by the Invertebrate Iridescent Virus 6 (also known as Chilo iridescent virus). It is a full-length protein consisting of 542 amino acids . The protein contains characteristic domains of cysteine proteinases, which are enzymes that use a catalytic cysteine residue for protein hydrolysis. The protein is part of the viral structural proteome, with IIV6 virions containing 54 virally encoded proteins determined through proteomic analysis .

What is the taxonomic classification of the source virus?

IIV6-361L is derived from Invertebrate iridescent virus 6 (IIV-6) which belongs to the family Iridoviridae . This virus is a nucleocytoplasmic pathogen with a relatively large dsDNA genome (~212 kb) that encodes 215 putative open reading frames . Unlike arboviruses that can infect both invertebrates and vertebrates, IIV6 is primarily an invertebrate-restricted virus, though it has demonstrated interesting interactions with mammalian innate immune systems in experimental settings .

How is recombinant IIV6-361L typically produced for research purposes?

Recombinant IIV6-361L protein is typically produced using E. coli expression systems with a His-tag for purification purposes . The production process involves:

  • Cloning the full-length IIV6-361L gene (encoding amino acids 1-542) into an appropriate expression vector

  • Transforming the construct into E. coli expression strains

  • Inducing protein expression under optimized conditions

  • Purifying the His-tagged protein using affinity chromatography

  • Performing quality control assessments including SDS-PAGE, Western blotting, and activity assays

For functional studies, researchers should verify that the recombinant protein maintains its native conformation and enzymatic activity after purification.

How does IIV6-361L contribute to viral pathogenesis?

As a cysteine proteinase, IIV6-361L likely plays multiple roles in viral pathogenesis:

  • Protein processing: It may cleave viral polyproteins into functional units

  • Host defense evasion: Potential degradation of host immune factors

  • Cell death modulation: Possible involvement in virus-induced apoptosis

Research on related viral cysteine proteinases suggests these enzymes often target specific host defense proteins. The study of IIV6-361L interactions can be approached using proteomics techniques similar to those used in other viral systems, including co-immunoprecipitation and mass spectrometry to identify cellular substrates .

What immune responses does IIV6 trigger in mammalian systems?

While IIV6 is an invertebrate-restricted DNA virus, research has demonstrated that it can induce a type I interferon-dependent antiviral immune response in mammalian cells. Specifically:

  • IIV6 activates a RIG-I-like receptor (RLR) pathway, not the canonical DNA sensing pathway via cGAS/STING

  • RNA polymerase III is required for maximal IFN-β secretion, suggesting viral DNA is transcribed into an RNA species capable of activating the RLR pathway

  • The mammalian innate immune response to IIV6 is functionally capable of protecting cells from subsequent infection with arboviruses such as Vesicular Stomatitis virus and Kunjin virus

This represents a novel example of an invertebrate DNA virus activating a canonically RNA-sensing pathway in the mammalian innate immune response. Whether IIV6-361L specifically contributes to this immune stimulation requires further investigation.

How can RNA interference techniques be applied to study IIV6-361L function?

RNA interference (RNAi) provides a powerful approach for investigating the function of viral proteins. For IIV6-361L research, the following methodology can be employed:

  • Design gene-specific double-stranded RNAs (dsRNAs) targeting the IIV6-361L sequence

  • Introduce these dsRNAs into virus-infected cells

  • Measure the effects on viral replication, transcription of other viral genes, and viral titer

Similar techniques were successfully applied to study another IIV6 protein (415R), demonstrating that gene silencing resulted in significantly reduced virus titers and affected transcription of other viral genes . This approach could elucidate the role of IIV6-361L in the viral life cycle.

What are optimal methods for detecting IIV6-361L expression and localization?

Researchers investigating IIV6-361L can employ the following techniques for detection and localization studies:

  • Western blot analysis: Using specific antibodies against IIV6-361L or its epitope tag (e.g., His-tag)

  • Immunofluorescence microscopy: For cellular localization studies

  • Transmission electron microscopy (TEM) with immunogold labeling: To precisely determine the location of IIV6-361L within viral particles

For example, in studies with IIV6 415R protein, researchers used western blot hybridization and immunogold electron microscopy to determine protein localization within virus particles, revealing that the protein remained associated with virions even after treatment with Triton X-100 to degrade the viral envelope . Similar approaches could be applied to study IIV6-361L localization.

What assays are appropriate for measuring IIV6-361L protease activity?

As a cysteine proteinase, IIV6-361L activity can be measured using several approaches:

  • Fluorogenic substrate assays:

    • Using peptide substrates linked to fluorogenic groups that emit measurable signals upon cleavage

    • Activity can be monitored in real-time using plate readers

  • Gel-based assays:

    • Incubating IIV6-361L with potential protein substrates and analyzing cleavage products via SDS-PAGE

    • Western blotting to identify specific cleavage fragments

  • Cell-based assays:

    • Transfection of cells with IIV6-361L expression constructs followed by proteomics analysis

    • Monitoring cellular substrate degradation through immunoblotting

Appropriate controls should include known cysteine protease inhibitors (such as E-64 or iodoacetamide) to confirm the specificity of observed activity.

How can protein-protein interaction studies identify IIV6-361L binding partners?

To identify viral and host proteins that interact with IIV6-361L, researchers can employ:

  • Yeast two-hybrid screening:

    • Using IIV6-361L as bait to screen viral and host protein libraries

    • This approach successfully identified interactions between IIV6 structural proteins, revealing that 415R protein interacts with envelope protein 118L and major capsid protein 274L

  • Co-immunoprecipitation (Co-IP):

    • Using antibodies against IIV6-361L or its epitope tag to pull down protein complexes

    • Mass spectrometry analysis of co-precipitated proteins

  • Proximity labeling techniques:

    • BioID or APEX2 fusion proteins for in vivo labeling of proximal proteins

    • This approach can identify transient interactions that might be missed by Co-IP

  • Surface plasmon resonance or biolayer interferometry:

    • For quantitative measurements of binding kinetics between IIV6-361L and candidate interacting proteins

How does IIV6-361L compare to cysteine protease inhibitors in host immune systems?

While IIV6-361L functions as a cysteine proteinase, host organisms often produce cysteine protease inhibitors (CPIs) as part of their immune defense. Comparing these systems:

  • Structure-function relationship:

    • IIV6-361L contains catalytic domains typical of cysteine proteases

    • Host CPIs like BsCPI-1 contain conserved sequences of cystatin proteins

  • Immunomodulatory effects:

    • Host CPIs such as BsCPI-1 can induce macrophage polarization toward the M2 subtype, exerting immunosuppressive effects

    • This occurs through the TLR2/4 signaling pathway

    • The immunomodulatory effects of IIV6-361L remain to be fully characterized

This comparison provides insight into the evolutionary arms race between viral proteases and host inhibitors, potentially informing therapeutic strategies against viral infection.

What role might IIV6-361L play in cross-species viral recognition?

Although IIV6 is an invertebrate virus, research has shown it can interact with mammalian immune systems:

  • IIV6 activates the RIG-I-like receptor pathway in mammalian cells, despite RIG-I being absent in invertebrates (where Dicer acts as the antiviral RNA sensor)

  • This activation involves:

    • RNA polymerase III-mediated transcription of viral DNA into RNA

    • Subsequent recognition by RIG-I pathway components

    • Production of type I interferons

  • The resulting immune response has been shown to restrict subsequent infection by arboviruses such as VSV and Kunjin virus

Future research should investigate whether IIV6-361L specifically contributes to these cross-species recognition events, perhaps through the generation of pathogen-associated molecular patterns (PAMPs) that activate mammalian immune sensors.

What are the recommended protocols for analyzing IIV6-361L effects on cellular pathways?

When investigating IIV6-361L's impact on cellular signaling, researchers should consider:

  • Phosphorylation analysis:

    • Western blotting with phospho-specific antibodies targeting key signaling molecules (IRF3, STAT1, IκB)

    • Primary antibody labeling protocols:

      • anti-IRF3 (1:1,000)

      • anti-P-IRF3 (1:2,000)

      • anti-STAT1 (1:1,000)

      • anti-P-STAT (1:1,000)

      • anti-IκB (1:1,000)

      • anti-P-IκB (1:1,000)

  • Transcriptional reporter assays:

    • ISRE-reporter assays to measure interferon-stimulated response element activation

    • Dual-luciferase reporter systems for normalization

  • ELISA for cytokine production:

    • Collecting supernatant from infected/transfected cells

    • Measuring IFN-β and other cytokines using commercial kits

  • Nuclear translocation assays:

    • Immunofluorescence microscopy for NFκB nuclear translocation

    • Using confocal imaging with appropriate antibodies and nuclear counterstains

What statistical approaches are most appropriate for analyzing IIV6-361L experimental data?

For robust statistical analysis of IIV6-361L research data:

  • Express all data as mean ± SD

  • Perform statistical analysis using software such as GraphPad Prism 5.0

  • Use ImageJ software to quantify band intensities from Western blots

  • Assess differences between groups by one-way analysis of variance (ANOVA) in SPSS 26.0 software

  • Consider p ≤ 0.05 as statistically significant

When comparing multiple experimental conditions (e.g., wild-type virus vs. IIV6-361L-silenced virus vs. controls), appropriate post-hoc tests should be employed following ANOVA to account for multiple comparisons.

What are the major unresolved questions regarding IIV6-361L function?

Several key questions remain unanswered about IIV6-361L:

  • Substrate specificity:

    • What are the specific viral and/or host proteins cleaved by IIV6-361L?

    • How does this substrate specificity compare to other viral cysteine proteases?

  • Structural insights:

    • What is the three-dimensional structure of IIV6-361L?

    • How does structure relate to its enzymatic function?

  • Role in viral life cycle:

    • Is IIV6-361L essential for viral replication?

    • At what stage of the viral life cycle is IIV6-361L most active?

  • Evolution and conservation:

    • How conserved is IIV6-361L among different iridoviruses?

    • What selective pressures have shaped its evolution?

How can advanced technologies enhance IIV6-361L research?

Emerging technologies can address knowledge gaps about IIV6-361L:

  • CRISPR-Cas9 genome editing:

    • Creating precise mutations in the IIV6-361L gene to study structure-function relationships

    • Generating viral mutants with modified or deleted IIV6-361L

  • Cryo-electron microscopy:

    • Determining the high-resolution structure of IIV6-361L

    • Visualizing IIV6-361L in the context of the intact virion

  • Single-cell transcriptomics:

    • Analyzing heterogeneity in host cell responses to IIV6-361L expression

    • Identifying cell populations particularly sensitive to IIV6-361L activity

  • Proteome-wide association studies:

    • Comprehensive identification of IIV6-361L substrates and interacting partners

    • Mapping the cellular impact of IIV6-361L activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.