Recombinant Invertebrate iridescent virus 6 Transmembrane protein 010R (IIV6-010R)

What is Invertebrate iridescent virus 6 and how is it classified?

Invertebrate iridescent virus 6 (IIV-6), also known as Chilo iridescent virus, belongs to the family Iridoviridae. It is a large, icosahedral, double-stranded DNA virus that infects invertebrates. IIV-6 has a complex genome encoding numerous proteins involved in viral replication and host immune evasion. The virus derives its name from the iridescent appearance of heavily infected host tissues, which results from the paracrystalline arrangement of virus particles that creates a diffraction grating effect. IIV-6 has been used extensively as a model system for studying virus-host interactions in invertebrates, particularly in Drosophila models where immune response mechanisms are well characterized .

What is known about the structure and basic properties of IIV6-010R protein?

IIV6-010R is a 120-amino acid transmembrane protein encoded by the Invertebrate iridescent virus 6 genome. Its amino acid sequence is: MNNFNYFNGKMVEDILENPDEDILNPDKSKTKDIVIKEDFCGACLALPLAFAGAGTATAT SGDTSGNKSKSSIFFWSVVISIIGLIATVWFLSGDCTTCVSEGNSRGKRTGSMVCSSTR . The protein contains hydrophobic regions consistent with its characterization as a transmembrane protein. Recombinant versions of the protein can be produced with tags such as His-tags to facilitate purification and experimental manipulation. The protein appears to be expressed during the viral life cycle, though the exact timing of its expression in relation to other viral proteins requires further investigation .

How does IIV-6 inhibit NF-κB signaling in host cells, and what role might IIV6-010R play?

IIV-6 demonstrates a sophisticated inhibition of both Imd and Toll NF-κB signaling pathways in Drosophila. Research indicates that this inhibition occurs at a point downstream of several key signaling events. For the Imd pathway, viral inhibition takes place after Imd cleavage, Relish cleavage, and even after some nuclear translocation of Relish. This suggests that IIV-6 likely targets the process at the level of Relish DNA binding or transcriptional activation . While the specific role of IIV6-010R in this process has not been definitively established, its transmembrane nature suggests it could potentially interfere with host signaling complexes at cellular membranes or participate in trafficking viral inhibitory factors to appropriate cellular compartments.

The mechanism appears to be mediated by immediate early gene products or factors delivered with the virion, as treatments with cidofovir (a viral polymerase inhibitor) or heat/UV-inactivated virus still blocked NF-κB-dependent antimicrobial peptide production . Researchers investigating IIV6-010R should consider whether it functions as part of this early inhibitory mechanism, potentially through protein-protein interactions or by altering membrane properties important for signaling complex formation.

What experimental approaches are most effective for investigating IIV6-010R interactions with host proteins?

Investigating IIV6-010R interactions with host proteins requires a multi-faceted approach. Co-immunoprecipitation experiments using tagged recombinant IIV6-010R can identify binding partners from host cell lysates. This should be complemented with reverse co-immunoprecipitation using antibodies against suspected host partners. Yeast two-hybrid screens can also identify potential interacting proteins, though results should be validated with alternative methods due to potential false positives.

For membrane proteins like IIV6-010R, techniques that preserve the membrane environment are particularly valuable. Proximity labeling methods such as BioID or APEX can identify proteins in close proximity to IIV6-010R within living cells. Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) can detect protein-protein interactions in situ while maintaining the cellular context. Given IIV-6's ability to inhibit NF-κB signaling, researchers should specifically investigate interactions between IIV6-010R and components of the Imd and Toll pathways, paying particular attention to factors involved in Relish binding to DNA or transcriptional activation .

How can researchers differentiate between the effects of IIV6-010R and other viral proteins on immune suppression?

Differentiating the specific contributions of IIV6-010R from other viral proteins requires several complementary approaches. One strategy is to express IIV6-010R alone in a host cell system and assess its impact on NF-κB signaling through reporter assays measuring antimicrobial peptide gene expression. Researchers can use Drosophila S2* cells treated with 20-hydroxyecdysone and stimulated with peptidoglycan (for Imd pathway) or cleaved Spätzle (for Toll pathway) as established in previous protocols .

Generating IIV-6 mutants with deleted or modified IIV6-010R would provide direct evidence of its role, though this approach is technically challenging with large DNA viruses. Another approach is to use RNA interference to knock down IIV6-010R expression during viral infection and observe effects on immune suppression. Complementary to this, researchers can design dominant-negative versions of IIV6-010R that might interfere with the function of the wild-type protein during infection.

It's important to note that IIV-6, like other large DNA viruses, likely employs multiple redundant mechanisms to inhibit host immunity, so elimination of a single factor might not produce a clear phenotype . Therefore, combinatorial approaches targeting multiple viral factors simultaneously may be necessary to fully elucidate the role of IIV6-010R.

What are the optimal conditions for expressing and purifying recombinant IIV6-010R?

For optimal expression of recombinant IIV6-010R in E. coli systems, consider the following protocol:

• Clone the full-length coding sequence (amino acids 1-120) into an expression vector with an N-terminal His-tag.

• Transform into an E. coli strain optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3)).

• Grow cultures at 37°C until reaching OD600 of 0.6-0.8.

• Induce protein expression with a lower IPTG concentration (0.1-0.5 mM) at reduced temperature (16-25°C) overnight to promote proper folding of the membrane protein.

• Harvest cells and lyse using mild detergents suitable for membrane proteins (e.g., n-dodecyl-β-D-maltoside or CHAPS).

• Purify using nickel affinity chromatography under conditions that maintain the native protein conformation.

• Consider size exclusion chromatography as a second purification step to enhance purity.

• Verify protein identity by Western blot and mass spectrometry.

For transmembrane proteins like IIV6-010R, maintaining the protein in a soluble and properly folded state is challenging. The use of appropriate detergents throughout the purification process is critical. Additionally, researchers should assess protein quality through circular dichroism or other structural characterization methods to ensure that the recombinant protein retains its native structure .

What assays can be used to measure IIV6-010R's impact on NF-κB signaling pathways?

To measure IIV6-010R's potential impact on NF-κB signaling, researchers can employ several complementary assays:

• Reporter Gene Assays: Transfect cells with NF-κB-responsive luciferase reporter constructs along with an expression vector for IIV6-010R. Stimulate the pathway with appropriate ligands (e.g., peptidoglycan for Imd, cleaved Spätzle for Toll) and measure reporter activity .

• qRT-PCR Analysis: Measure expression levels of antimicrobial peptide genes like Diptericin (Imd pathway) or Drosomycin (Toll pathway) in cells expressing IIV6-010R following pathway stimulation .

• Immunoblotting: Assess key signaling events such as Imd cleavage, Relish cleavage, and IκB degradation in the presence or absence of IIV6-010R .

• Nuclear Translocation Assays: Use fluorescently tagged Relish or other NF-κB factors to track nuclear translocation following stimulation in cells expressing IIV6-010R. This can be quantified using confocal microscopy and image analysis software .

• Chromatin Immunoprecipitation (ChIP): Determine whether IIV6-010R affects NF-κB factor binding to promoter regions of target genes.

• In Vivo Infection Models: For a more comprehensive assessment, compare susceptibility to bacterial challenges (e.g., Erwinia carotovora carotovora) in Drosophila expressing IIV6-010R versus controls, similar to the co-infection experiments performed with the complete virus .

How can researchers design experiments to study the timing of IIV6-010R expression during viral infection?

To study the timing of IIV6-010R expression during viral infection, researchers can implement the following experimental approaches:

• Time-Course Western Blotting: Infect susceptible cells with IIV-6 and collect samples at various time points post-infection (e.g., 0, 2, 4, 6, 12, 24, 48 hours). Analyze IIV6-010R protein levels by Western blotting using antibodies specific to the protein.

• qRT-PCR Analysis: Extract RNA from infected cells at various time points and perform qRT-PCR to measure IIV6-010R mRNA levels relative to other viral transcripts (immediate early, early, and late genes).

• Metabolic Labeling: Perform pulse-chase experiments with radioactive amino acids at different times post-infection to identify when IIV6-010R is actively synthesized.

• Reporter Constructs: Generate recombinant IIV-6 with the IIV6-010R promoter driving a reporter gene (e.g., GFP) to visualize the timing of promoter activation during infection.

• Inhibitor Studies: Use specific inhibitors of viral DNA replication (e.g., cidofovir) to determine whether IIV6-010R expression depends on viral DNA replication, which would classify it as an early or late gene rather than an immediate early gene .

• Immunofluorescence Microscopy: Perform time-course immunofluorescence studies to track both the timing of expression and the subcellular localization of IIV6-010R during infection.

Notably, prior research has indicated that IIV-6-mediated NF-κB inhibition occurs even when viral replication is blocked, suggesting involvement of immediate early genes or virion-associated factors . Determining whether IIV6-010R fits this profile would provide valuable insights into its potential role in immune evasion.