Recombinant Invertebrate iridescent virus 6 Transmembrane protein 049L (IIV6-049L)
Description
Introduction to Recombinant Invertebrate Iridescent Virus 6 Transmembrane Protein 049L (IIV6-049L)
Recombinant Invertebrate Iridescent Virus 6 Transmembrane Protein 049L, denoted as IIV6-049L, is a protein derived from the Invertebrate Iridescent Virus 6 (IIV-6), also known as Chilo iridescent virus. This protein is expressed in Escherichia coli and is available with a His-tag for research purposes. The IIV6-049L protein is a full-length transmembrane protein, consisting of 123 amino acids, and is used in various life sciences research applications.
2.1. Protein Structure and Function
The IIV6-049L protein is a recombinant form of the native protein found in IIV-6. It is designed to facilitate studies on viral structure, replication, and interaction with host cells. The protein's structure includes a His-tag at the N-terminus, which aids in purification and detection.
2.2. Expression and Purification
IIV6-049L is expressed in E. coli and purified using standard techniques such as SDS-PAGE. The purity of the protein is typically greater than 90%, ensuring high-quality material for research applications.
3.2. Interacting Proteins
While specific interacting proteins for IIV6-049L are not well-documented, its transmembrane nature suggests potential interactions with other viral proteins or host cell membranes.
4.2. Amino Acid Sequence
The amino acid sequence of IIV6-049L starts with MDKIEELKIEELKIEIPQRKTKFFHDSENSDKRDEEETLNPTITSKAKILIKSKNFWIETLIFVISVFGALCVAFGIMLIGFLLWLVSNTISILYFIKQKQYPLSLQQMVFLITTCIGVYNNV.
Product Specs
Note: While we prioritize shipping the format currently in stock, specific format requests should be noted during order placement to ensure fulfillment.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Tag type is determined during production. If you require a specific tag, please specify this at the time of order, and we will prioritize its inclusion.
Target Background
KEGG: vg:1733420
