Recombinant Invertebrate iridescent virus 6 Transmembrane protein 213R (IIV6-213R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is assigned during production. If you require a specific tag, please inform us, and we will prioritize its use.
Synonyms
IIV6-213R; Transmembrane protein 213R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-522
Protein Length
full length protein
Species
Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus)
Target Names
IIV6-213R
Target Protein Sequence
MSKQKLWIDDLNSFFGDWSLIPTSKMTREEKLNTITRLILIASLVLLLFGKKDASLYILI IGLIIVIVIYSQEKPSTVEGFEIINGEIVDDEGEKNEIATNLGTPSSYQGGASKGRTIGG VTLPGGRAPIYTCNVTYYPTTMSGNSVMITGKNNALVGPQNPKTLMPPPIAPPLGDLDTW KASEWTTHSHVNSRTVQYEDEAGPFRTFNNNDERVLPVNCLSSYEDDQANNPCFRRYQSG IGIKNEIGIMEPFEHTPNLIKGETPPLIKELDEPYEPTFARRANDEKDIIEPFISELQPG IYSSNIDQPILDNAGLLPDMPQPQTTLFTPMINGKPRDKMQIYVEDKEADAIPGITDSGY HTLDRAYDLPQRYVRERLPKRYGEWRARRSTMPGIPFETPVGYGSGARPIGSFPTEGAVV SPPGNACTGWVTGIENVRDLSGQSEMSEYYNKNKLDMFDVDENAPLYAINPDAVKMHIDV TNRFRSDMQESLMRKRNAEAWQRKMYPLDTNHRRMLGGTGQF
Uniprot No.

Target Background

Database Links

KEGG: vg:1733197

Protein Families
IIV-6 213R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Invertebrate iridescent virus 6 (IIV-6) and how is it studied in laboratory settings?

IIV-6, also known as Chilo iridescent virus, is a member of the Iridovirus genus within the Iridoviridae family. It has a broad host range and can replicate in various Dipteran species, including Drosophila melanogaster, making it a valuable model for studying dsDNA virus infections in invertebrates .

In laboratory settings, researchers primarily study IIV-6 using the following approaches:

  • Intraabdominal inoculation of adult Drosophila

  • Monitoring viral replication through iridescence in the eyes, thorax, and abdomen

  • Western blot analysis to detect virion coat proteins in infected tissues

  • Viral titer quantification at different time points post-infection

  • Small RNA sequencing to study host immune responses

The effectiveness of IIV-6 as a research model is demonstrated by its ability to establish productive infections in Drosophila, with infected flies showing characteristic iridescence resulting from paracrystalline arrays of virus particles .

What is the genomic structure of IIV-6 and where does the 213R protein fit?

IIV-6 possesses a relatively large dsDNA genome of 212,482 base pairs that encodes 211 putative open reading frames (ORFs) distributed across both strands of the viral genome . These ORFs are organized with approximately 45% encoded on the upper strand (referred to as the R strand) and 55% on the lower strand (the L strand) .

The transmembrane protein 213R is one of these ORFs, designated by its position and orientation in the genome. The "R" in 213R indicates it is encoded on the R strand. While the specific location and complete sequence characteristics of 213R are not detailed in the provided search results, transmembrane proteins in dsDNA viruses typically play crucial roles in viral entry, assembly, or modulation of host cell processes.

What host-pathogen interactions are observed during IIV-6 infection?

IIV-6 engages in several significant host-pathogen interactions during infection:

  • RNAi Response Targeting: IIV-6 is targeted by the RNA interference (RNAi) antiviral immune response in Drosophila. This process involves:

    • Viral dsRNA generation during infection, likely from convergent overlapping transcription

    • Processing of viral dsRNA by Dicer-2 (Dcr-2) into viral small interfering RNAs (vsiRNAs)

    • Loading of vsiRNAs into Argonaute-2 (AGO2) complexes

  • Immune Suppression Mechanisms: IIV-6 actively inhibits host NF-κB signaling pathways:

    • Suppresses both Imd and Toll pathways, which are key for antimicrobial responses

    • Blocks antimicrobial peptide (AMP) gene induction

    • The inhibition occurs downstream of Relish cleavage and nuclear translocation, likely at the level of promoter binding or transcriptional activation

  • Enhanced Susceptibility to Secondary Infections: IIV-6-infected flies show increased vulnerability to bacterial pathogens:

    • Flies with IIV-6 infection succumb more rapidly when secondarily infected with the Gram-negative bacterium Erwinia carotovora carotovora

    • This represents a promising model for studying co-infection dynamics

How is the presence of IIV-6 detected and quantified in experimental samples?

Multiple techniques can be employed to detect and quantify IIV-6 in experimental samples with varying sensitivity and precision:

  • Visual Observation: Characteristic iridescence in infected tissues resulting from paracrystalline arrays of virions

  • Protein Detection:

    • Western blot analysis using antibodies against IIV-6 virion coat proteins

    • Immunofluorescence microscopy with virus-specific antibodies

  • Nucleic Acid-Based Detection:

    • PCR amplification of viral genomic sequences

    • Small RNA sequencing to detect virus-derived small interfering RNAs

  • Cell Culture-Based Methods:

    • Infectivity assays using susceptible cell lines (differential susceptibility observed among cell lines)

    • Viral plaque assays for quantification

  • Fluorescent Reporter Systems:

    • Recombinant IIV-6 expressing fluorescent proteins (e.g., mCherry under control of the major capsid protein promoter)

The optimal detection method depends on research objectives, with nucleic acid-based methods generally offering higher sensitivity for detection of low-level infections.

What experimental approaches are used to produce recombinant IIV6-213R protein for functional studies?

Production of recombinant viral transmembrane proteins requires specialized techniques due to their hydrophobic domains and potential toxicity to expression systems. For IIV6-213R, researchers typically employ:

  • Expression System Selection:

    • Bacterial systems (e.g., E. coli BL21(DE3)) with specialized vectors for membrane proteins

    • Eukaryotic systems such as insect cell lines (Sf9, S2) for better folding and post-translational modifications

    • Cell-free expression systems for highly toxic membrane proteins

  • Vector Design Considerations:

    • Incorporation of purification tags (His, GST, MBP) at non-critical domains

    • Use of inducible promoters to control expression timing and levels

    • Inclusion of fusion partners to enhance solubility

  • Membrane Protein Extraction Protocol:

    • Gentle cell lysis methods to preserve transmembrane domain integrity

    • Use of appropriate detergents (DDM, LDAO, or Triton X-100) for solubilization

    • Density gradient ultracentrifugation for membrane fraction isolation

  • Purification Strategy:

    • Detergent exchange during purification to maintain protein stability

    • Size exclusion chromatography to ensure homogeneity

    • Validation of proper folding through circular dichroism spectroscopy

For functional studies, researchers often incorporate fluorescent tags or epitope tags that allow tracking without disrupting protein function, particularly when studying transmembrane dynamics.

How do mutations in the IIV6-213R protein affect viral pathogenesis in experimental systems?

While specific data on IIV6-213R mutations are not directly available in the search results, a methodological approach to studying transmembrane protein mutations would include:

  • Mutation Design Strategy:

    • Scanning mutagenesis of transmembrane domains to identify critical residues

    • Site-directed mutagenesis targeting conserved motifs

    • Creation of chimeric proteins with related viral transmembrane proteins

  • Virus Engineering Methods:

    • Generation of recombinant IIV-6 expressing mutant 213R using homologous recombination

    • Development of trans-complementation systems to study lethal mutations

    • Use of conditional expression systems to study essential protein functions

  • Phenotypic Analysis Techniques:

    • Viral replication kinetics in cell culture systems

    • Electron microscopy to assess virion morphology

    • Host range determination to identify host-specific effects

  • Molecular Interaction Studies:

    • Co-immunoprecipitation to identify altered protein-protein interactions

    • Liposome binding assays to assess membrane interaction properties

    • Immunofluorescence microscopy to track subcellular localization changes

Mutation TypeExpected EffectExperimental Approach
Transmembrane domain substitutionAltered membrane insertionMembrane fractionation assays
Conserved motif disruptionFunctional impairmentViral replication kinetics
Cytoplasmic domain mutationModified host protein interactionsCo-immunoprecipitation studies
Signal sequence alterationMislocalizationImmunofluorescence tracking

How does the RNAi pathway interact with IIV-6 infection, and what methodologies reveal these interactions?

The interaction between the RNAi pathway and IIV-6 infection represents a critical aspect of antiviral immunity in Drosophila. Research methodologies that elucidate these interactions include:

  • Genetic Approaches:

    • Analysis of viral susceptibility in Dcr-2 and Argonaute-2 (AGO2) mutant flies

    • Creation of transgenic flies expressing viral suppressors of RNAi

  • Small RNA Sequencing:

    • Deep sequencing of small RNAs from infected tissues

    • Mapping of viral siRNAs (vsiRNAs) to the viral genome

    • Size distribution analysis of vsiRNAs (typically 19-30 nucleotides)

  • Biochemical Validation:

    • Immunoprecipitation of AGO2 complexes followed by small RNA sequencing

    • In vitro dicing assays using purified Dcr-2 and viral dsRNA

Research has demonstrated that Dcr-2 and AGO2 mutant flies show increased sensitivity to IIV-6 infection, indicating that the RNAi pathway contributes to controlling DNA virus infection . Small RNA sequencing has identified abundant vsiRNAs produced in a Dcr-2-dependent manner, confirming the direct role of this pathway in the antiviral response against IIV-6 .

What mechanisms does IIV-6 employ to inhibit NF-κB immune signaling, and how can these be experimentally investigated?

IIV-6 inhibits both major Drosophila NF-κB signaling pathways (Imd and Toll), suppressing antimicrobial peptide responses. The mechanisms and experimental approaches include:

  • Pathway Inhibition Characteristics:

    • Suppression occurs downstream of Relish cleavage and nuclear translocation

    • Inhibition likely targets Relish promoter binding or transcriptional activation

  • Experimental Investigation Approaches:

    • Protein Cleavage Analysis: Western blotting reveals that Imd and Relish cleavage still occur in IIV-6 infected cells when stimulated with pathway activators

    • Nuclear Translocation Studies: Using YFP-Relish expressing cell lines to track protein localization

    • Promoter Binding Assays: Chromatin immunoprecipitation (ChIP) to assess Relish binding to antimicrobial peptide gene promoters

    • Transcriptional Reporter Systems: Luciferase reporters driven by NF-κB-responsive promoters

  • In Vivo Validation:

    • Measurement of antimicrobial peptide gene expression in IIV-6 infected flies

    • Survival analysis of flies with co-infections (IIV-6 and bacteria)

    • Testing candidate viral proteins for immune suppression activity

A key finding is that flies infected with IIV-6 show suppressed expression of antimicrobial peptide genes (Diptericin and Drosomycin) and increased susceptibility to otherwise mild bacterial infections . When infected with both IIV-6 and Erwinia carotovora carotovora, flies reached 50% mortality by day 7 post-bacterial infection, with nearly 100% lethality by day 20, compared to much longer survival in singly infected controls .

What experimental design considerations are critical when studying IIV-6 proteins in different research contexts?

When designing experiments to study IIV-6 proteins, including transmembrane protein 213R, several methodological considerations are essential:

  • Experimental Design Framework:

    • Clear definition of research objectives

    • Construction of appropriate designs including randomization

    • Determination of required replicates

    • Selection of appropriate models for data analysis

  • Cell Line Selection Considerations:

    • Differential susceptibility exists among cell lines

    • Higher susceptibility observed in specific Drosophila cell lines

    • Consider using cells derived from natural hosts

  • Infection Protocol Standardization:

    • Consistent viral stock preparation

    • MOI (multiplicity of infection) standardization

    • Timing of measurements post-infection

  • Controls and Variables:

    • Inclusion of mock-infected controls

    • Time-matched sampling

    • Consideration of viral factory formation in cytoplasm when studying cellular localization

  • Technical Challenges and Solutions:

    • Viral infected cells may adhere poorly to coverslips (use specialized coatings)

    • Cytoplasmic viral factories can complicate nuclear identification (use nuclear envelope markers like Lamin)

    • Fluorescent protein signals may be reduced in infected cells (consider fixation and antibody staining)

Experimental ApproachKey ConsiderationsRecommended Controls
Protein expression studiesDetergent selection for membrane proteinEmpty vector expression
Co-infection experimentsTiming between primary and secondary infectionSingle infection controls
Localization studiesDistinguishing nucleus from viral factoriesNuclear envelope markers
Immune response analysisTiming of immune stimulationStimulation-only controls

What emerging technologies could advance our understanding of IIV6-213R protein function?

Several cutting-edge technologies hold promise for elucidating the structure and function of IIV6-213R:

  • Cryo-Electron Microscopy:

    • High-resolution structural determination of membrane proteins in near-native states

    • Visualization of 213R in the context of the intact virion

  • Single-Molecule Techniques:

    • FRET (Förster Resonance Energy Transfer) to study dynamic conformational changes

    • Single-particle tracking to monitor protein movement in live cells

  • CRISPR-Based Approaches:

    • Precise genome editing of viral genomes to create targeted mutations

    • CRISPRi/CRISPRa systems to modulate viral gene expression

  • Proteomics Applications:

    • Proximity labeling (BioID, APEX) to identify host interaction partners

    • Quantitative proteomics to identify changes in host protein abundance

  • Computational Approaches:

    • Molecular dynamics simulations of transmembrane domain interactions

    • AI-driven protein structure prediction for difficult-to-crystallize proteins

These methodologies would complement traditional biochemical and genetic approaches to provide a comprehensive understanding of IIV6-213R function in viral biology.

How can blocked response surface designs improve IIV-6 protein expression optimization?

Optimizing the expression of complex viral transmembrane proteins like IIV6-213R requires sophisticated experimental design approaches. Blocked response surface (BRS) designs offer particular advantages:

  • Principles of BRS Design Application:

    • Allows systematic exploration of multiple parameters affecting protein expression

    • Accommodates blocking factors like different expression batches or equipment variations

    • Enables identification of optimal conditions while controlling for experimental variability

  • Implementation Methodology:

    • Identification of critical factors (temperature, inducer concentration, time)

    • Selection of appropriate response variables (protein yield, solubility, activity)

    • Development of statistical models to predict optimal conditions

  • Advantages for Membrane Protein Expression:

    • Efficiently explores detergent type and concentration effects

    • Optimizes induction conditions to balance expression and toxicity

    • Identifies interaction effects between variables that might be missed in one-factor-at-a-time approaches

  • Data Analysis Approach:

    • Fit appropriate statistical models to the experimental data

    • Validate models through confirmation experiments

    • Develop response surface plots to visualize optimization landscape

The application of BRS designs allows researchers to efficiently identify optimal conditions for IIV6-213R expression with fewer experimental runs than traditional approaches while accounting for experimental variability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.