Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 056R (IIV6-056R)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 056R (IIV6-056R) relates to studies of the Insect iridescent virus 6 (IIV6), also known as Chilo iridescent virus (CIV), which is the type species of the genus Iridovirus and a member of the family Iridoviridae . Research on IIV6-056R involves the creation of recombinant viruses to study viral replication dynamics and to insert foreign genes into the virus genome .

Recombinant Virus Construction

The construction of recombinant viruses, such as those involving IIV6, uses homologous recombination to insert foreign genes or create gene knockouts . For example, a recombinant CIV was engineered to express green fluorescent protein (GFP) by inserting the gfp open reading frame, driven by the viral mcp promoter, into the 157L locus of the virus in Anthonomus grandis BRL-AG-3A cells . The resulting recombinant virus, rCIV-Δ157L-gfp, produced fluorescent plaques and had similar growth kinetics and in vivo infectivity compared to the wild-type virus, indicating that the 157L gene could be inactivated without affecting viral replication .

Significance of IIV6-056R Research

IIV6-056R research aims to understand the functional roles of specific viral genes and their potential applications in insect biocontrol . Creating recombinant viruses allows researchers to modify viral properties by inserting foreign DNA, offering possibilities for developing novel biocontrol agents .

IIV-6 and Mammalian Immune Response

IIV-6, although a DNA virus, can induce a type I interferon-dependent antiviral immune response in mammalian cells through the RIG-I-like receptor (RLR) pathway . This immune response is mediated by the RLR pathway, rather than the canonical DNA sensing pathway via cGAS/STING, and requires RNA polymerase III to transcribe viral DNA into an RNA species that activates the RLR pathway . The activation of the mammalian innate immune response by IIV-6 can protect cells from subsequent infection by arboviruses like Vesicular Stomatitis virus and Kunjin virus .

RNA Interference (RNAi) Response to IIV-6

In Drosophila melanogaster, the DNA virus IIV-6 is a target of the RNAi machinery . Studies have shown that Dcr-2 and Argonaute-2 mutant flies are more sensitive to IIV-6 infection, suggesting that viral small interfering RNAs (vsiRNAs) contribute to controlling DNA virus infection . Deep sequencing of small RNAs from IIV-6-infected flies identified abundant vsiRNAs produced in a Dcr-2-dependent manner .

Data Table: Excel's Tool for Data Sensitivity Analysis

Excel's Data Table is a tool for sensitizing data by using various assumptions . It involves creating a blank table, linking the top left cell to the output being sensitized, running the Data Table tool, and formatting the table . Common errors in using Data Tables include issues with workbook calculation settings, reversed input cells, incorrect linking of row/column headings, placing the Data Table on a different worksheet than the original inputs, and inconsistent locking/unlocking of cells .

Steps to create a Data Table :

  1. Create a blank table with assumptions for revenue growth across the top and EBITDA margins along the left.

  2. Link the top left cell of the table to the value being recalculated (e.g., 2019 EBITDA).

  3. Highlight the entire table and select Data Table (Data > What-If Analysis > Data Table).

  4. Select the revenue growth rate as the "Row input cell" and EBITDA margin as the "Column input cell."

  5. Format the table and set the font color of the top left cell to white to make it invisible.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If a specific tag is required, please inform us, and we will prioritize its inclusion.
Synonyms
IIV6-056R; Uncharacterized protein 056R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus)
Target Names
IIV6-056R
Target Protein Sequence
MEQKIDKKNSYSFGITSSTTVHVLGEVVAIGGILYYTHSQVNQLNTKIASLEKQILDLTN ILKHLSPHSFQQLQSSPTTQSTPPLPQSTPQSQQSQQSAVLPQRPSFLGGSTPKESQSFP GVETRSLGEKTTRGKLKSPHPSQIPVTQENFHYPYQTMNKTMRWEFLKPVESDESEDETN CQNGVCTLQKQEKNVTFNGSVEQLKYGNFSPQRSTKTMIGSPSIRPLIPHESIESVSESI ESSQDQSFSSRETISGNFKSKDDHQLSESEINQLVSKAIRTKK
Uniprot No.

Target Background

Database Links

KEGG: vg:1733282

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Invertebrate Iridescent Virus 6 (IIV-6) and what is the significance of studying the 056R protein?

Invertebrate Iridescent Virus 6 (IIV-6), also called Chilo Iridescent Virus, is a large DNA virus belonging to the family Iridoviridae, genus Iridovirus, in the Betairidovirinae subfamily . It has a broad host range among invertebrates but cannot productively infect vertebrate cells . IIV-6 possesses a linear dsDNA genome of 212,482 bp that encodes 211 putative ORFs distributed along both strands of the viral genome .

The 056R protein is one of the uncharacterized proteins encoded by the IIV-6 genome. Studying this protein is significant because:

  • It may play a role in the virus's ability to evade or manipulate host immune responses

  • Understanding its function could reveal novel virus-host interactions

  • As an uncharacterized protein, it represents an opportunity to discover new viral mechanisms

Methodological approach: To investigate the significance of IIV6-056R, researchers typically employ comparative genomic analyses across different iridoviruses, protein structure prediction, and functional assays in susceptible cell lines. Experimental design should include knockdown/knockout studies followed by phenotypic characterization of viral replication efficiency .

What are the optimal conditions for handling and storing recombinant IIV6-056R protein?

Optimal handling and storage conditions for recombinant IIV6-056R protein are critical for maintaining its stability and activity:

ParameterRecommended ConditionNotes
Storage temperature-20°C (short-term)
-80°C (long-term)
For extended storage, conserve at -20°C or -80°C
Buffer compositionTris-based buffer with 50% glycerolOptimized for protein stability
Freeze-thaw cyclesMinimize repeated freezing/thawingStore working aliquots at 4°C for up to one week
Working temperature4°CFor routine handling and experiments

Methodological approach: When designing experiments with recombinant IIV6-056R, researchers should prepare small working aliquots to avoid multiple freeze-thaw cycles. Prior to use, samples should be thawed on ice and centrifuged briefly to collect the solution. Protein stability should be verified by SDS-PAGE after storage periods to ensure experimental reproducibility .

How does the temporal regulation of IIV6-056R expression influence experimental design for functional studies?

The expression of IIV6-056R is temporally regulated during viral infection, which significantly impacts experimental design for functional studies. Research has demonstrated that IIV-6 genes are divided into three kinetic classes: immediate-early (IE), delayed-early (DE), and late (L) . Understanding which class IIV6-056R belongs to is crucial for proper experimental timing.

Transcriptional analysis of IIV-6 genes has identified specific motifs associated with each gene class:

  • IE genes: AA(A/T)(T/A)TG(A/G)A motif

  • DE genes: (T/A/C)(T/G/C)T(T/A)ATGG motif

  • L genes: Complex regulation involving both activator and repressor sequences

Methodological approach: To account for temporal expression in functional studies, researchers should:

  • Determine the kinetic class of IIV6-056R using RT-PCR with protein and DNA synthesis inhibitors

  • Design time-course experiments with appropriate sampling points based on expression timing

  • Use promoter-reporter assays to validate regulatory elements controlling 056R expression

  • Consider synchronizing infection when studying protein-protein interactions involving IIV6-056R

These approaches are critical as premature or delayed sampling may miss the window of expression, leading to false negative results in interaction or functional studies .

What methods are most sensitive for detecting IIV-6 replication and IIV6-056R expression in experimental systems?

Multiple detection methods have been compared for sensitivity and precision in detecting IIV-6, each with specific applications for tracking viral replication and protein expression:

MethodDetection LimitApplicationsAdvantages/Limitations
Spectrophotometry1.6×10⁹-5.6×10¹⁰ particles/mlViral quantificationLinear relationship between concentration and absorbance at 260nm; less sensitive than other methods
Cell Culture (TCID₅₀)Varies by cell lineInfectious virus quantificationDrosophila cell lines (DL2, DR1) most sensitive; Aedes and Plutella cell lines less sensitive by 4 orders of magnitude
Insect Bioassay1-10 particles per larvaDetection of covert infections20-26% infection rate at 1 particle/larva; 100% at doses ≥50 particles
PCR~1000 particlesMolecular detection95% detection at 1000 particles; 41% detection rate compared to bioassay for covert infections
qPCRVariableViral genome quantificationCan track viral load over time; requires specific primers for IIV-6 capsid
ELISAProtein-dependentProtein expressionSuitable for detecting IIV6-056R specifically with appropriate antibodies

Methodological approach: For comprehensive analysis of IIV-6 replication and IIV6-056R expression, researchers should implement a multi-method approach:

  • Initial quantification of viral stock using spectrophotometry and TCID₅₀ assays

  • Track viral genome replication using qPCR with primers specific for IIV-6 capsid (Fwd: TACAACACCTGCGTCAAAGG; Rev: TGCAGGAGCAACAGGTACAG)

  • Monitor IIV6-056R expression using specific antibodies or tagged recombinant constructs

  • Confirm productive infection via transmission electron microscopy to visualize viral particles

This integrated approach ensures reliable detection across different aspects of the viral life cycle and protein expression dynamics.

How does IIV-6 activate mammalian innate immune responses, and what role might IIV6-056R play in this process?

Although IIV-6 is restricted to infect invertebrates, research has demonstrated that it can induce a type I interferon-dependent antiviral immune response in mammalian cells. This response involves several key mechanisms:

  • Despite being a DNA virus, IIV-6 activates the RIG-I-like receptor (RLR) pathway, not the canonical DNA sensing pathway via cGAS/STING

  • RNA polymerase III is required for maximal IFN-β secretion, suggesting viral DNA is transcribed into RNA species capable of activating the RLR pathway

  • The RLR-driven mammalian innate immune response to IIV-6 can protect cells from subsequent infection with arboviruses like Vesicular Stomatitis virus and Kunjin virus

While the specific role of IIV6-056R in immune modulation remains uncharacterized, several hypotheses warrant investigation:

  • IIV6-056R may interact with components of the RNA sensing pathway

  • The protein could potentially inhibit or modulate interferon signaling

  • It might play a role in viral evasion of host defenses in the natural invertebrate host

Methodological approach: To investigate the potential immunomodulatory functions of IIV6-056R:

  • Express recombinant IIV6-056R in mammalian cells and measure changes in interferon production using ELISA for IFN-β

  • Perform co-immunoprecipitation to identify potential interactions with RLR pathway components

  • Compare immune responses between wild-type IIV-6 and a modified virus lacking functional 056R

  • Conduct reporter assays using ISRE-firefly luciferase to measure interferon signaling in the presence of IIV6-056R

These experiments would help determine whether IIV6-056R contributes to the unique ability of this DNA virus to activate RNA sensing pathways.

What approaches can be used to determine the function of the uncharacterized IIV6-056R protein in viral replication?

Determining the function of uncharacterized viral proteins requires a systematic approach combining genetic, biochemical, and cellular techniques:

ApproachMethodologyExpected Outcome
Reverse GeneticsCreate viral mutants with deleted or modified 056R geneIdentify phenotypic changes in viral replication, morphology, or host range
Protein Interaction StudiesYeast two-hybrid, co-immunoprecipitation, mass spectrometryIdentify host or viral protein binding partners
Localization AnalysisFluorescence microscopy with tagged IIV6-056RDetermine subcellular localization during infection
TranscriptomicsRNA-seq of infected cells with and without 056RIdentify changes in host gene expression dependent on 056R
Structural BiologyX-ray crystallography, cryo-EM, or NMRReveal structural features that might suggest function

Methodological approach: A comprehensive strategy to characterize IIV6-056R function would include:

  • Determine the temporal expression class of IIV6-056R using RT-PCR analysis with protein and DNA synthesis inhibitors

  • Generate recombinant viruses with mutations in the 056R gene using technologies similar to those used for directed integration in other viral systems

  • Analyze viral replication kinetics in both insect cells (e.g., S2 cells) and during in vivo infection (e.g., in Galleria mellonella larvae)

  • Examine virion morphology using transmission electron microscopy to detect structural abnormalities

  • Perform comparative proteomics between wild-type and 056R-mutant virions to determine if the protein is incorporated into viral particles

This multi-faceted approach would provide complementary lines of evidence for the functional role of IIV6-056R in the viral life cycle.

How can researchers optimize expression systems for recombinant IIV6-056R production?

Optimizing expression systems for recombinant IIV6-056R production requires careful consideration of multiple factors:

Expression SystemAdvantagesDisadvantagesOptimization Parameters
E. coliFast growth, high yields, economicalPotential improper folding, lack of post-translational modificationsStrain selection, induction conditions, solubility tags
YeastEukaryotic PTMs, proper foldingLonger production time, lower yields than E. coliHost strain (e.g., SMD1168, GS115, X-33)
Insect cellsNative-like environment, appropriate PTMsComplex cultivation, higher costCell line (Sf9, Sf21, High Five) , viral vector
Mammalian cellsMost authentic PTMs and foldingHighest cost, lowest yieldsCell line (293T, CHO, etc.) , transfection method

Methodological approach: For optimal production of functional IIV6-056R:

  • Codon optimization: Adapt the IIV6-056R coding sequence to the codon bias of the expression host to improve translation efficiency

  • Fusion tags: Test different fusion partners (His, FLAG, MBP, GST) to enhance solubility and facilitate purification

  • Expression conditions: Systematically optimize temperature, inducer concentration, and induction timing

  • Purification strategy: Develop a multi-step purification process including affinity chromatography followed by size exclusion chromatography

  • Quality control: Verify protein identity by mass spectrometry, purity by SDS-PAGE, and activity through functional assays

For insect cell expression specifically, using Sf9 cells with baculovirus expression systems may provide the most native-like environment for proper folding and potential post-translational modifications of IIV6-056R .

What are the methodological challenges in studying virus-host interactions using IIV-6 as a model system?

Studying virus-host interactions using IIV-6 presents several methodological challenges that researchers must address:

  • Dual host system complexity: IIV-6 naturally infects invertebrates but can induce immune responses in mammalian cells without productive infection, creating complex experimental scenarios

  • Viral genome size: The large 212,482 bp genome encoding 211 ORFs complicates genetic manipulation and functional genomics approaches

  • Limited genetic tools: Fewer genetic tools exist for studying invertebrate viruses compared to mammalian viruses

  • Distinguishing between patent and covert infections: IIV-6 can establish covert (inapparent) infections that are difficult to detect without specialized methods

Methodological approach: To address these challenges, researchers should:

  • Employ parallel experimental systems (invertebrate and mammalian) with appropriate controls

  • Use multiple detection methods with varying sensitivities (PCR, bioassay, cell culture) to confirm infection status

  • Develop reverse genetics systems adapted specifically for large DNA viruses

  • Implement CRISPR-Cas9 methods for targeted genome editing of IIV-6

  • Design experiments that account for the temporal regulation of viral gene expression

How can researchers differentiate between specific effects of IIV6-056R and general responses to IIV-6 infection?

Differentiating specific effects of IIV6-056R from general responses to IIV-6 infection requires carefully controlled experimental approaches:

ApproachMethodologyControl Considerations
Genetic ManipulationCreate 056R-null mutant virusCompare to wild-type and revertant viruses
Ectopic ExpressionExpress IIV6-056R in uninfected cellsInclude appropriate vector-only controls
Temporal AnalysisMonitor effects at different infection stagesCorrelate with known 056R expression timing
Cell Type SpecificityTest effects across multiple cell typesIdentify cell-specific vs. general responses
Domain MappingCreate truncated/mutated versions of 056RIdentify functional domains responsible for effects

Methodological approach: A comprehensive strategy to isolate IIV6-056R-specific effects would include:

  • Generate recombinant IIV-6 variants with targeted mutations in the 056R gene

  • Perform parallel transcriptomic and proteomic analyses comparing wild-type and 056R-mutant infections

  • Use inducible expression systems to control 056R expression timing independently of infection

  • Implement RNA interference or CRISPR approaches to knock down 056R expression during infection

  • Conduct cross-complementation studies with 056R homologs from related iridoviruses to identify conserved functions

This multi-faceted approach would help distinguish between effects specifically attributable to IIV6-056R and those resulting from general viral infection processes.

What analytical techniques can resolve contradictory data regarding IIV6-056R function across different experimental systems?

When faced with contradictory data regarding IIV6-056R function across different experimental systems, researchers should implement advanced analytical techniques for resolution:

  • Meta-analysis approaches:

    • Systematically compare experimental conditions across studies

    • Identify variables that correlate with observed differences

    • Perform statistical analyses to determine significant factors

  • Orthogonal validation methods:

    • Confirm results using independent techniques (e.g., validate protein interactions found by co-IP with FRET or proximity ligation assays)

    • Test in multiple cell lines or model organisms

    • Employ both in vitro and in vivo approaches

  • Systems biology integration:

    • Construct network models incorporating all available data

    • Identify nodes where contradictions occur

    • Design targeted experiments to resolve specific conflicts

Methodological approach: When contradictory results emerge regarding IIV6-056R function:

  • Compare experimental conditions focusing on cell types, viral strains, and methodological differences

  • Evaluate temporal aspects, as effects may differ based on infection stage or protein expression timing

  • Assess protein modification status across systems, as post-translational modifications may alter function

  • Conduct dose-response experiments to determine whether contradictions result from concentration-dependent effects

  • Develop mathematical models that can accommodate apparently contradictory data by identifying conditional dependencies

These analytical approaches can help resolve contradictions and develop a more nuanced understanding of IIV6-056R's context-dependent functions.

How can studying IIV6-056R contribute to understanding broader mechanisms of virus-host interactions?

Studying IIV6-056R represents a valuable opportunity to understand broader mechanisms of virus-host interactions for several reasons:

  • As an uncharacterized protein from an evolutionarily distinct virus family, IIV6-056R may reveal novel interaction mechanisms not observed in more well-studied viruses

  • IIV-6's unique ability to trigger RNA-sensing pathways despite being a DNA virus suggests unconventional mechanisms that may involve proteins like 056R

  • Comparison with homologs across diverse iridoviruses can illuminate evolutionary patterns in viral immune evasion strategies

Methodological approach: To maximize the broader impact of IIV6-056R research:

  • Perform comparative genomic and structural analyses across the Iridoviridae family to identify conserved features

  • Investigate potential convergent evolution between IIV6-056R and functionally similar proteins from unrelated viruses

  • Develop systems for high-throughput screening of IIV6-056R interactions with host factors across multiple species

  • Explore the potential of IIV6-056R as a tool for manipulating cellular pathways in research applications

These approaches could position IIV6-056R research to contribute fundamental insights into viral strategies for host manipulation beyond the specific context of IIV-6 infection.

What emerging technologies could advance our understanding of IIV6-056R structure and function?

Several emerging technologies hold particular promise for advancing our understanding of IIV6-056R structure and function:

TechnologyApplication to IIV6-056R ResearchPotential Insights
AlphaFold and other AI protein structure predictionGenerate high-confidence structural modelsPredict functional domains and interaction interfaces
Cryo-electron microscopyDetermine high-resolution structureVisualize IIV6-056R alone or in complex with binding partners
Proximity labeling proteomics (BioID, APEX)Identify transient interaction partnersMap the protein's interaction network within the cell
Single-cell RNA-seqAnalyze heterogeneous responses to IIV6-056RIdentify cell populations particularly affected by the protein
CRISPR interference/activationModulate host factors to identify genetic dependenciesDiscover cellular pathways required for IIV6-056R function

Methodological approach: Implementing these technologies would require:

  • Developing expression systems for producing functional IIV6-056R suitable for structural studies

  • Creating fusion constructs for proximity labeling that maintain native protein function

  • Establishing single-cell analytical pipelines for infected and transfected cells

  • Designing CRISPR screens targeting specific cellular pathways potentially involved in IIV6-056R function

These emerging approaches could overcome current limitations in studying this uncharacterized protein and accelerate understanding of its structural and functional properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.