Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 060L (IIV6-060L)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Invertebrate Iridescent Virus 6 Uncharacterized Protein 060L (IIV6-060L)

Recombinant Invertebrate Iridescent Virus 6 Uncharacterized Protein 060L (IIV6-060L) is a protein derived from the Invertebrate Iridescent Virus 6 (IIV6), a member of the Iridoviridae family. IIV6 is known for its large genome size, encoding numerous proteins, some of which remain uncharacterized. The IIV6-060L protein is one such uncharacterized protein, and its recombinant form has been expressed in Escherichia coli for research purposes.

Characteristics of IIV6-060L Protein

The recombinant IIV6-060L protein is a full-length protein consisting of 236 amino acids (1-236aa) and is fused with an N-terminal His tag to facilitate purification and detection. This protein is expressed in E. coli, which is a common host for recombinant protein production due to its ease of manipulation and high yield.

CharacteristicsDescription
Protein Length236 amino acids
Expression HostEscherichia coli
TagN-terminal His tag
Gene InformationEncoded by IIV6 genome

Future Directions

Future research should focus on elucidating the function of IIV6-060L within the context of IIV6 infection. This could involve:

  • Functional Analysis: Investigating the protein's interactions with other viral components or host cell machinery.

  • Immunological Studies: Examining the immune response elicited by IIV6-060L in both invertebrate and mammalian hosts.

  • Biotechnological Applications: Exploring potential uses in vaccine development or as a tool for studying viral-host interactions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
IIV6-060L; Uncharacterized protein 060L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-236
Protein Length
full length protein
Species
Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus)
Target Names
IIV6-060L
Target Protein Sequence
MSKNKSPLLNESEKMMSEMLPMKVSQSKLNYEEKVYIPTTIRNRKQHCFRRFFPYIALFQ IIMLIILLILYFCFPNLFYSTNFNTNFNTSLLQNNSIETKLNSIPPQNNSQKTEVPIILN YTTQKTEVTEPIIINNTTEEIETQTIMIPKSTDQTQTIISAKTTAIISPPETSETIAQVL KNSDKREHDDEELSFTTEMETITTETETSSTIPHLRSLPIKSESSMETTSEETDEE
Uniprot No.

Target Background

Database Links

KEGG: vg:1733027

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is IIV6-060L and what organism does it originate from?

IIV6-060L is an uncharacterized protein encoded by the Invertebrate iridescent virus 6 (IIV-6), also known as Chilo iridescent virus. It is a full-length protein consisting of 236 amino acids that can be produced recombinantly with a His-tag in E. coli expression systems . The virus itself was originally isolated from the stem-boring moth Chilo suppressalis, though it can infect various invertebrate hosts .

What are the known structural characteristics of IIV6-060L?

Based on available data, IIV6-060L is a 236 amino acid protein that can be expressed as a recombinant protein with affinity tags such as His-tag . Despite being classified as "uncharacterized," its presence in the IIV-6 proteome suggests potential involvement in viral processes. The protein's full sequence is known, but detailed three-dimensional structural information, domain organization, and functional motifs have not been well-characterized in the scientific literature. Additional structural studies using X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy would be necessary to elucidate its structural features.

What are the most sensitive methods for detecting IIV-6 in experimental samples?

Several methods have been evaluated for their sensitivity in detecting IIV-6:

MethodSensitivityApplications
Spectrophotometric (A260)Linear detection between 1.6×10^9-5.6×10^10 particles/mlQuantification of purified viral preparations
Cell culture (Drosophila DL2, DR1)Highest cellular susceptibilityIn vitro assays, virus titration
Insect bioassay (G. mellonella)Detection of as few as 1-10 particlesHigh sensitivity biological assay
PCR95% detection at 1000 particlesMolecular detection in complex samples

The G. mellonella bioassay provides highly reliable detection at doses of 10 particles or more and can determine relative activity at doses as low as 1 particle per insect. PCR shows slightly lower sensitivity, followed by cell culture assays . For comprehensive detection, combining multiple methods is recommended based on specific research requirements.

How can researchers effectively distinguish between patent and covert IIV-6 infections in experimental models?

Differentiating between patent (obvious) and covert (hidden) IIV-6 infections requires a systematic approach:

For patent infections, researchers typically observe:

  • Visible iridescence in infected tissues

  • Clear mortality patterns

  • High viral loads detectable by standard methods

For covert infections, more sensitive techniques are required:

  • The G. mellonella bioassay has proven particularly effective, detecting covert infections in 5.8-75% of surviving insects that showed no obvious symptoms

  • Secondary transfer experiments, where tissue from apparently healthy specimens is injected into naive G. mellonella larvae, can reveal hidden infections

  • PCR techniques detected approximately 41% of covert infections that were positive in bioassays

A comprehensive detection protocol would involve initial screening for patent infections, followed by secondary transfer to G. mellonella for detecting covert infections, with PCR confirmation as a molecular verification method.

What is currently known about the immunomodulatory properties of IIV-6 proteins and their potential relevance to IIV6-060L?

While the specific function of IIV6-060L remains uncharacterized , IIV-6 as a virus has demonstrated significant immunomodulatory capabilities, particularly in suppressing NF-κB signaling pathways in Drosophila. The virus inhibits both the Imd and Toll pathways, which are critical components of the insect immune response against bacterial and fungal infections .

Key findings about IIV-6 immunomodulation include:

  • Antimicrobial peptide (AMP) gene induction downstream of both Imd and Toll pathways is suppressed in IIV-6 infected cells

  • The inhibition occurs downstream of key signal transduction events, including cleavage of both Imd and Relish proteins

  • The mechanism appears to operate at the level of Relish promoter binding or transcriptional activation

Whether IIV6-060L contributes to these immunomodulatory effects remains an open question that warrants investigation through targeted gene knockout studies, protein-protein interaction analyses, and comparative approaches with other viral immunomodulators.

How might researchers determine if IIV6-060L plays a role in the viral inhibition of NF-κB signaling pathways?

To investigate whether IIV6-060L contributes to NF-κB signaling inhibition, researchers should implement a multi-faceted approach:

  • Gene knockout/knockdown studies:

    • Generate recombinant IIV-6 lacking the 060L gene

    • Compare NF-κB pathway inhibition between wild-type and mutant viruses

  • Heterologous expression studies:

    • Express IIV6-060L alone in Drosophila cells or flies

    • Measure AMPs induction following immune stimulation

    • Compare with control expressions of other viral proteins

  • Protein-protein interaction studies:

    • Perform co-immunoprecipitation with tagged IIV6-060L

    • Use yeast two-hybrid or proximity labeling approaches

    • Conduct mass spectrometry to identify interacting host factors

  • Chromatin immunoprecipitation (ChIP) assays:

    • Determine if IIV6-060L affects Relish binding to target promoters

    • Compare chromatin accessibility at NF-κB-dependent genes

These approaches would help determine if IIV6-060L specifically contributes to the documented inhibition of NF-κB responses, which occurs downstream of Relish nuclear translocation, likely at the level of DNA binding or transcriptional activation .

What insights can be gained from studying IIV6-060L in the context of co-infection models?

Studies have demonstrated that IIV-6 infected flies succumb more rapidly to infection with the Gram-negative bacterium Erwinia carotovora carotovora (Ecc15) compared to flies with single infections . This establishes a valuable model for studying co-infection dynamics and immune suppression.

Investigating IIV6-060L in this context could provide insights into:

  • Mechanism of viral-bacterial synergy:

    • Does IIV6-060L specifically contribute to increased bacterial susceptibility?

    • Is the effect pathogen-specific or a general immune suppression phenomenon?

  • Temporal dynamics of immune modulation:

    • How quickly after expression of IIV6-060L does immune suppression occur?

    • Is the effect reversible upon removal/inhibition of the protein?

  • Host range implications:

    • Does IIV6-060L affect conserved immune pathways across different insect species?

    • Could this explain aspects of the virus's host range?

  • Evolutionary considerations:

    • Is IIV6-060L under positive selection, suggesting host-pathogen coevolution?

    • How conserved is this protein across related iridoviruses?

The co-infection model provides a powerful system to investigate the biological significance of IIV6-060L's potential role in immune modulation, with implications for understanding both viral pathogenesis and host defense mechanisms .

What experimental challenges arise when studying protein translocation and function in IIV-6 infected cells, and how can they be addressed?

Studying protein dynamics in IIV-6 infected cells presents several technical challenges that researchers must overcome:

  • Cell adhesion issues:

    • IIV-6 infected cells adhere poorly to coverslips

    • Solution: Test multiple surface coatings or fixation protocols optimized for infected cells

  • Reduced fluorescent protein signals:

    • Infected cells often display reduced YFP-tagged protein signals

    • Solution: Use alternative fluorescent tags or antibody-based detection methods that may be more stable in infected cells

  • Difficulty distinguishing cellular compartments:

    • IIV-6 undergoes massive viral DNA replication in cytoplasmic viral factories

    • The viral factories can be difficult to distinguish from the nucleus

    • Solution: Use multiple nuclear markers simultaneously (e.g., Hoechst 33342 combined with nuclear envelope markers like Lamin)

  • Quantification challenges:

    • In studies of Relish nuclear translocation, approximately 44-50% of cells showed ambiguous localization or weak signals

    • Solution: Develop clear scoring criteria and use automated image analysis when possible

These technical solutions have enabled researchers to determine that IIV-6 inhibition of Imd signaling occurs downstream of Relish nuclear translocation, likely at the level of promoter binding or transcriptional activation .

How might IIV6-060L contribute to the development of novel biocontrol strategies for insect pests?

Understanding IIV6-060L's function could inform novel biocontrol approaches, particularly if the protein plays a role in the virus's documented immunosuppressive effects . Potential applications include:

  • Enhanced viral biocontrol agents:

    • If IIV6-060L proves important for suppressing host immunity, overexpression could create more virulent strains for pest control

    • Targeted modifications could enhance host specificity to protect beneficial insects

  • Synergistic pest management:

    • IIV-6 infected insects show increased susceptibility to bacterial infections

    • This synergy could be exploited in integrated pest management with lower doses of chemical insecticides

  • Novel insecticidal proteins:

    • If IIV6-060L directly disrupts insect immune functions, the protein or derivatives could be developed as targeted biopesticides

    • Transgenic crops expressing optimized versions could provide protection against specific pests

  • Resistance management:

    • Understanding the mechanism of immune suppression could help prevent or delay resistance development to biocontrol strategies

    • Multiple viral factors targeting different aspects of immunity could be combined for more sustainable control

These applications would require thorough safety and environmental impact assessments, particularly regarding host range specificity and potential effects on non-target organisms.

What are the most promising approaches for structural determination of IIV6-060L and what functional insights might they provide?

Determining the structure of IIV6-060L would significantly advance understanding of its function. Based on current protein characterization methodologies, the following approaches are recommended:

  • Recombinant protein production optimization:

    • Express in E. coli with affinity tags for purification

    • Test multiple expression conditions to maximize soluble protein yield

    • Consider insect cell expression systems for more native post-translational modifications

  • Complementary structural determination methods:

    • X-ray crystallography for high-resolution structure determination

    • NMR spectroscopy for dynamic regions and smaller domains

    • Cryo-electron microscopy for larger complexes or membrane-associated forms

    • Hydrogen-deuterium exchange mass spectrometry to map functional regions

  • Structure-function correlation:

    • Domain mapping through limited proteolysis and mass spectrometry

    • Site-directed mutagenesis of predicted functional residues

    • Functional assays in cell culture systems, such as reporter assays for NF-κB activity

    • In vitro binding assays with potential interaction partners from host immune pathways

Structural insights could reveal similarity to known immunomodulatory proteins, identify potential interaction interfaces with host factors, and guide the development of inhibitors or derivatives with tailored properties for research or applied purposes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.