Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 067R (IIV6-067R)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
IIV6-067R; Uncharacterized protein 067R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-456
Protein Length
full length protein
Species
Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus)
Target Names
IIV6-067R
Target Protein Sequence
MKTIIIRKIPPIDDFKRFVPKRFSRFPQLYLELLENKNKVKLNCIGKEFVPTTPPLSTGR
ETIVSKDPHVVQSSISNTPIRTEIKDTPRYEETPIKRTITVTNVKTVKSSSISGMNGRNR
LYDDDLFDDDRYKSPTTRKFQGEKRDEDIRLIPKSSNIGSSKYKPVLTRVEENENKKIHI
DQRKESIVNDERKKNPEFREKPDKNEDKKVKPPPSLKEIENKGIDHEENEEDKKRELMFK
LQLLQKQYPLRDIPDFTIRSEYKSMKKTYDIIVKQLSVDSSVETYKNYLVGGFMVCEMVF
GRIGFDMEGFTQQQLLSMNSYEKLLLELGEKTYTPAGMDKWPVEVRLALAILFNAVWFIA
AKMIMKKTKINILSLFNNTKGLNKSGTTPNSVSPRTWGNSKSPQSEFNFIGRKNENNSVG
RTQMKGPSINRIDEGFGSESDESRREMREQGIETLK
Uniprot No.
Target Background
Database Links
KEGG: vg:1733049
Protein Families
IIV-6 067R family
Subcellular Location
Membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
