Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 084L (IIV6-084L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
IIV6-084L; Uncharacterized protein 084L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus)
Target Names
IIV6-084L
Target Protein Sequence
MAKVIKINLIVNKRMSPAIILIGVLILIVLFVIKFNSSEVSSILTSEVTSEGDDEHETET RETTGCISQLNTLRATLAAKKKELKTLRTARKKECTEQLAKTQAEVDRIQAKIDNFSSRT KIVPLPGGEVGPPYNPPPPRTNTRPNPRPNPRPAQLPQLYNYGYY
Uniprot No.

Target Background

Database Links

KEGG: vg:1733338

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Invertebrate Iridescent Virus 6 and how does it relate to mammalian immunity?

Invertebrate Iridescent Virus 6 (IIV-6), also known as Chilo Iridescent Virus, is a DNA virus belonging to the Iridoviridae family that primarily infects invertebrates. Despite being an invertebrate virus, IIV-6 has been shown to induce a type I interferon-dependent antiviral immune response in mammalian cells. This response is mediated through the RIG-I-like receptor (RLR) pathway rather than the canonical DNA sensing pathway via cGAS/STING, despite IIV-6 being a DNA virus . This unusual activation pattern makes IIV-6 a valuable model for studying cross-species immune recognition mechanisms.

What methodological approaches are recommended for initial characterization of IIV6-084L?

When approaching the uncharacterized protein 084L, researchers should implement a multi-faceted characterization strategy:

  • Sequence analysis: Begin with computational analyses including homology searches, domain prediction, and phylogenetic comparisons.

  • Expression system selection: Based on initial sequence analysis, select appropriate expression systems (bacterial, insect cell, or mammalian systems) for recombinant production.

  • Biochemical characterization: Perform size-exclusion chromatography, circular dichroism, and thermal stability assays.

  • Functional screening: Develop targeted assays based on predicted functions, such as nucleic acid binding, enzymatic activity, or protein-protein interactions.

  • Cellular localization: Use fluorescently tagged constructs to determine subcellular localization in both insect and mammalian cells.

Each characterization step should follow robust experimental design principles with appropriate controls to establish reliability and reproducibility .

How can researchers distinguish between direct effects of IIV6-084L and general immune responses to the virus?

Distinguishing specific protein effects from general viral responses requires careful experimental design:

  • Isolated protein studies: Express and purify recombinant IIV6-084L to study its effects independently from the whole virus.

  • Comparative analysis: Compare immune responses between wild-type IIV-6 and genetically modified virus lacking functional 084L.

  • Domain mapping: Create truncated or point-mutated versions of IIV6-084L to identify functional domains.

  • Temporal analysis: Perform time-course experiments to determine when 084L is expressed during viral infection and correlate with observed phenotypes.

  • Single-cell analysis: Use single-cell approaches to identify cell-specific responses to the protein versus general viral infection markers.

These approaches help isolate the specific contributions of IIV6-084L to observed phenotypes during viral infection .

What experimental design principles should guide research on uncharacterized viral proteins like IIV6-084L?

When designing experiments for uncharacterized viral proteins, researchers should implement advanced experimental design principles:

  • Factorial designs: Utilize factorial experimental designs to efficiently test multiple parameters affecting protein expression, purification, or function simultaneously.

  • Response surface methodology: Apply this approach to optimize critical parameters such as expression conditions, buffer composition, and purification protocols.

  • Nested designs: Implement nested experimental designs when investigating host-specific effects across different cell types or species.

  • Randomized block designs: Use these designs to control for batch effects in protein production or assay performance.

  • Split-plot designs: Consider split-plot designs when some experimental factors are difficult to randomize (such as incubation time or temperature conditions).

These structured approaches provide statistical robustness and maximize information gained while minimizing resource expenditure .

How should researchers approach inconsistent results when studying IIV6-084L?

Inconsistent experimental results with uncharacterized proteins are common and should be approached methodically:

  • Systematic variation analysis: Implement variance component analysis to identify sources of variation (reagents, cell lines, experimental conditions).

  • Robustness testing: Test protein stability and activity across various buffer conditions and storage methods.

  • Batch effect monitoring: Include inter-experimental controls and standards to normalize between experimental runs.

  • Method validation: Perform method validation studies with defined acceptance criteria before conducting critical experiments.

  • Multi-laboratory confirmation: For particularly challenging or controversial findings, establish collaborations for independent verification in different laboratories.

These approaches help distinguish between genuine biological phenomena and technical artifacts that may arise when working with novel viral proteins.

How can researchers investigate the potential role of IIV6-084L in RIG-I pathway activation?

Given that IIV-6 activates the RIG-I pathway despite being a DNA virus, investigating 084L's potential role in this process requires specialized approaches:

Table 1: Experimental Approaches for Studying IIV6-084L in RIG-I Pathway Activation

ApproachMethodologyReadoutAdvantagesLimitations
RNA-protein interactionRNA immunoprecipitation followed by sequencing (RIP-seq)Identification of RNA species bound by 084LDirect evidence of RNA bindingMay identify non-functional interactions
Pathway modulationExpression of 084L in mammalian cells with RIG-I pathway reportersIFN-β secretion (ELISA) and ISRE-luciferase activationFunctional readout in relevant systemMay miss cofactor requirements
Structure-function analysisMutational analysis of predicted RNA-binding domainsChanges in immunostimulatory activityMaps critical functional domainsRequires prediction of domains
Reconstitution assaysIn vitro reconstitution with purified componentsDirect biochemical activityMechanistic insightsMay not recapitulate cellular complexity
Inhibitor studiesRNA Pol III inhibition in the presence of 084LImpact on IFN-β productionTests requirement for Pol III transcriptionPotential off-target effects

Since RNA polymerase III is required for maximal IFN-β secretion during IIV-6 infection, researchers should investigate whether 084L interacts with this enzyme or its products .

What techniques are most appropriate for studying potential structural features of IIV6-084L?

For structural characterization of uncharacterized viral proteins, researchers should consider:

Each method provides complementary structural information, and integration of multiple approaches yields the most comprehensive understanding of protein structure-function relationships.

How might IIV6-084L contribute to cross-species immune activation?

IIV-6 uniquely activates mammalian immune responses despite being an invertebrate virus. When investigating 084L's potential role in this phenomenon:

  • Comparative immune stimulation: Express 084L in various cell types across species (insect, mammalian) and measure immune activation markers.

  • Receptor interaction screening: Perform binding assays between purified 084L and pattern recognition receptors from different species.

  • Evolutionary analysis: Conduct phylogenetic analyses to identify conserved features between 084L and known immunostimulatory proteins.

  • Chimeric protein studies: Create chimeric proteins between 084L and known immunostimulatory proteins to map functional domains.

  • Transcriptional profiling: Compare transcriptional responses to 084L across species using RNA-seq.

These approaches can reveal whether 084L possesses molecular features that enable cross-species recognition by immune receptors .

What experimental approaches can determine if IIV6-084L plays a role in protecting against subsequent arboviral infections?

IIV-6 infection has been shown to protect cells from subsequent infection with arboviruses like Vesicular Stomatitis virus and Kunjin virus . To investigate 084L's potential role:

  • Pretreatment studies: Pretreat cells with purified 084L before challenging with arboviruses.

  • Deletion mutant comparison: Compare protective effects between wild-type IIV-6 and 084L-deficient variants.

  • Pathway inhibition: Identify which protective pathways are activated by 084L using specific inhibitors of innate immune signaling.

  • Temporal analysis: Establish the kinetics of 084L expression relative to the development of protection.

  • Cross-protection spectrum: Test protection against diverse viral families to determine specificity.

Table 2: Experimental Design for Testing IIV6-084L Arboviral Protection

Experimental GroupPretreatmentChallengeReadout MeasurementsExpected Outcome if 084L is Protective
ControlMockArbovirusViral load, cell viabilityHigh viral load, low viability
Full virusIIV-6ArbovirusViral load, cell viabilityReduced viral load, increased viability
Protein onlyPurified 084LArbovirusViral load, cell viabilityReduced viral load if 084L is sufficient
Mutant virusIIV-6 Δ084LArbovirusViral load, cell viabilityHigher viral load than wild-type if 084L is necessary
Pathway inhibition084L + pathway inhibitorsArbovirusViral load, cell viabilityReversal of protection with specific inhibitors

How can multi-task learning approaches enhance the analysis of IIV6-084L experimental data?

Multi-task learning approaches, as described in healthcare data analytics, can be adapted for analyzing complex experimental data from IIV6-084L studies:

  • Temporal data integration: Apply multi-task learning to analyze time-course data from infection studies, treating each timepoint as a related task.

  • Multi-modal data fusion: Integrate data from different experimental platforms (proteomics, transcriptomics, functional assays) using shared parameter learning.

  • Feature selection: Identify the most relevant experimental features across multiple experimental conditions.

  • Missing data handling: Address incomplete datasets through adaptive matrix factorization approaches when experimental data points are missing.

  • Prediction modeling: Develop models that can predict functional outcomes from structural or sequence features.

These computational approaches can extract maximum information from complex experimental datasets, especially when studying proteins with unknown functions .

What approaches should researchers take when analyzing contradictory results about IIV6-084L function?

When faced with contradictory results regarding protein function:

  • Systematic review: Conduct a systematic analysis of all experimental conditions, reagents, and protocols that may contribute to differences.

  • Multivariate analysis: Apply principal component analysis or other dimension reduction techniques to identify key variables driving differences.

  • Mechanistic reconciliation: Develop testable hypotheses that could explain seemingly contradictory results (e.g., context-dependent functions, post-translational modifications).

  • Independent verification: Design critical experiments with new reagents and perform them in independent laboratories.

  • Meta-analysis: If sufficient data exists across studies, perform formal meta-analysis of quantitative results.

Contradictions often reveal important biological insights about context-dependent protein functions and should be explored rather than dismissed.

How might understanding IIV6-084L contribute to broader antiviral strategies?

Understanding IIV6-084L may have broader implications for antiviral research:

  • Novel adjuvant development: If 084L possesses strong immunostimulatory properties, it could be developed as a vaccine adjuvant.

  • Antiviral mechanism discovery: Studying how 084L activates immune pathways could reveal novel mechanisms for stimulating antiviral immunity.

  • Broad-spectrum viral inhibitors: If 084L confers protection against arboviruses, structural analogs might be developed as broad-spectrum antivirals.

  • Diagnostic applications: Antibodies against 084L could potentially serve as diagnostic markers for specific viral exposures.

  • Vector control strategies: Understanding IIV-6 biology could inform biocontrol approaches for insect vectors of human disease.

The unique cross-species activity of IIV-6 in stimulating mammalian immunity makes it particularly valuable for translational research bridging invertebrate and vertebrate antiviral mechanisms .

What research questions remain unaddressed regarding IIV6-084L?

Despite available research on IIV-6, several critical questions about 084L remain unexplored:

  • Structural characterization: What is the three-dimensional structure of 084L, and how does it compare to known immune-stimulating proteins?

  • Evolutionary conservation: Is 084L conserved across the Iridoviridae family, and what does this reveal about its function?

  • Host targets: What specific host proteins does 084L interact with in both invertebrate and vertebrate systems?

  • Viral lifecycle role: What is the primary function of 084L in the natural invertebrate host during viral replication?

  • Post-translational modifications: Are there critical modifications of 084L that regulate its function?

  • Therapeutic potential: Can recombinant 084L or derivatives be developed as immunomodulatory therapeutics?

Addressing these questions requires integrative approaches combining structural biology, functional genomics, and immunology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.