Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 169L (IIV6-169L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
IIV6-169L; Uncharacterized protein 169L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
full length protein
Species
Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus)
Target Names
IIV6-169L
Target Protein Sequence
MFSNISNQKLVLFFTIILIALCPFVYYLWDNEILGIGNWGRKRKDTFEDKNCSTEIEHAI EEHKRKNKEKKEAKEKRLAPGRVKISTYDVNNENYLLGDVNDELQPNIPGYLTKETAYPF DCEPDDRSNRWL
Uniprot No.

Target Background

Database Links

KEGG: vg:1733181

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Invertebrate iridescent virus 6 Uncharacterized protein 169L?

IIV6-169L is a protein encoded by the genome of Invertebrate iridescent virus 6 (IIV-6), also known as Chilo iridescent virus. This protein consists of 132 amino acids and is classified as an uncharacterized protein, meaning its exact biological function remains to be fully elucidated. The protein is conserved within the Iridoviridae family, suggesting potential functional importance in viral replication or host interaction processes .

What is the genomic context of IIV6-169L?

IIV6-169L is encoded within the genome of Invertebrate iridescent virus 6, which consists of 212,482 base pairs of linear double-stranded DNA containing 215 non-overlapping and putative protein-encoding open reading frames (ORFs) . The 169L designation indicates the relative position and orientation of this gene within the viral genome. Like other members of the Iridoviridae family, IIV-6 has a nucleocytoplasmic replication cycle, with the genome being relatively large and complex compared to many other insect viruses .

How is IIV6-169L functionally related to other viral proteins in the Iridoviridae family?

While IIV6-169L remains uncharacterized, research on related iridoviruses provides contextual understanding. Comparative genomic analyses between different iridoviruses (such as IIV-3, IIV-6, and IIV-9) have revealed patterns of conservation across the family . Unlike the well-characterized IIV6-118L envelope protein, which has been shown to be essential for virus replication and entry , the specific role of 169L has not been definitively established. Phylogenetic analysis of iridoviruses based on core gene sequences has helped establish evolutionary relationships that may inform functional predictions for proteins like 169L .

What expression systems are suitable for producing recombinant IIV6-169L?

Multiple expression systems have been successfully employed for the production of recombinant IIV6-169L, each with distinct advantages:

Expression SystemAdvantagesConsiderations
E. coliRapid growth, high yield, cost-effectiveMay have issues with proper folding of complex proteins
YeastPost-translational modifications, proper foldingLonger production time than E. coli
BaculovirusInsect cell-based, relevant for insect virus proteinsMore complex setup, but potential for native-like modifications
Mammalian cellMost sophisticated folding and modification machineryMost expensive, slower production

The choice of expression system should be guided by the specific research requirements, particularly if post-translational modifications or native structure is essential for functional studies .

What purification strategies are most effective for recombinant IIV6-169L?

The most common approach for purification of recombinant IIV6-169L utilizes affinity chromatography, typically with a histidine tag system. The standard protocol involves:

  • Cell lysis under native or denaturing conditions

  • Immobilized metal affinity chromatography (IMAC) using nickel or cobalt resins

  • Washing to remove non-specifically bound proteins

  • Elution with imidazole or pH gradient

  • Secondary purification steps (size exclusion, ion exchange) if higher purity is required

The aim is to achieve >85% purity as verified by SDS-PAGE, which is sufficient for most research applications . For specialized applications requiring higher purity, additional chromatography steps may be necessary.

How can protein expression be optimized for functional studies?

To optimize expression while maintaining functionality:

  • Consider in vivo biotinylation using the AviTag-BirA technology for proteins requiring labeling, which allows site-specific biotinylation. This method involves the BirA enzyme catalyzing an amide linkage between biotin and a specific lysine residue in the AviTag peptide .

  • Test multiple expression conditions (temperature, induction time, media composition) to balance yield with proper folding.

  • Evaluate different solubilizing agents and buffer conditions to enhance stability during purification.

  • Perform activity assays at different stages of purification to track retention of functionality.

What are the predicted structural features of IIV6-169L?

While the complete structural characterization of IIV6-169L remains to be determined, bioinformatic analyses suggest potential features that may inform its function. By comparison with other iridovirus proteins, particularly looking at the characterization of the IIV6-118L envelope protein, we can infer that IIV6-169L may possess:

  • Potential membrane-association domains

  • Possible protein-protein interaction motifs

  • Structural elements conserved across iridoviruses

Unlike the IIV6-118L protein which contains three transmembrane domains and several N-glycosylation/N-myristoylation sites , the specific structural elements of 169L require experimental validation through techniques such as X-ray crystallography or cryo-electron microscopy.

What experimental approaches are effective for functional characterization of IIV6-169L?

Based on successful approaches used for other iridovirus proteins, particularly the 118L protein, effective experimental strategies include:

  • Gene deletion studies: Employing homologous recombination to replace the 169L ORF with a reporter gene (such as GFP) to assess the impact on viral replication .

  • RNA interference: Using dsRNA targeting the 169L gene to silence its expression and observe the effects on virus titer and replication kinetics .

  • Antibody neutralization assays: Generating specific antibodies against recombinant 169L to test their ability to neutralize viral infection, which can indicate if the protein is exposed on the virion surface .

  • Protein-protein interaction studies: Implementing co-immunoprecipitation, yeast two-hybrid, or pull-down assays to identify host or viral proteins that interact with 169L .

  • Immunofluorescence microscopy: Determining the subcellular localization of 169L during different stages of viral infection.

How can IIV6-169L be used in viral pathogenesis studies?

IIV6-169L can serve as a valuable tool in several aspects of viral pathogenesis research:

  • As a model for studying protein function in large DNA viruses.

  • For investigating host-pathogen interactions, particularly in insect models such as Drosophila.

  • In comparative studies with other iridovirus proteins to identify conserved functional domains.

  • For developing potential antiviral strategies targeting viral proteins essential for replication.

When designing such studies, it's crucial to include appropriate controls similar to those used in the characterization of the 118L protein, where researchers verified the essential nature of the protein through multiple complementary approaches .

What host systems are most appropriate for studying IIV6-169L function?

Based on the available research:

Host SystemApplicationsAdvantages
Sf9/Sf21 cellsViral replication studiesNatural host cells for IIV replication at 21°C
Drosophila cellsImmune response studiesWell-characterized immune pathways (Imd and Toll)
G. mellonella larvaeIn vivo infection modelsNatural host for virus propagation

When selecting a host system, researchers should consider the specific aspects of viral-host interaction they aim to study, as different systems may reveal distinct functional properties of IIV6-169L.

How might IIV6-169L contribute to viral immune evasion mechanisms?

While the specific role of IIV6-169L in immune evasion has not been definitively established, research on IIV-6 demonstrates that this virus can inhibit host immune responses. Specifically, IIV-6 suppresses the Drosophila NF-κB signaling pathways (Imd and Toll), preventing antimicrobial peptide gene induction that would normally occur in response to infection .

Advanced research questions might explore:

  • Whether IIV6-169L plays a direct role in the observed suppression of NF-κB pathways

  • If 169L interacts with specific components of the host immune signaling cascade

  • How the function of 169L compares with known viral immune evasion proteins from other virus families

What bioinformatic approaches can advance understanding of IIV6-169L?

Advanced bioinformatic analyses to better understand IIV6-169L could include:

  • Comparative genomics across iridoviruses: Analyzing the conservation pattern of 169L orthologs across the Iridoviridae family, similar to the approach used for core iridovirus genes in IIV-9 analysis .

  • Structural prediction: Using AI-based structure prediction tools like AlphaFold to generate hypothetical 3D models of the protein.

  • Pathway interaction analysis: Predicting potential interactions with host immune signaling pathways based on structural motifs and sequence features.

  • Evolutionary analysis: Examining the selection pressure on 169L to identify rapidly evolving regions that might indicate host-specific adaptations.

How can anomaly detection in experimental data benefit IIV6-169L research?

Advanced research on IIV6-169L may generate complex datasets that require sophisticated analysis approaches. As noted in cybersecurity applications, anomaly detection techniques can help identify unexpected patterns in experimental data . In the context of IIV6-169L research, these approaches could:

  • Identify outliers in protein-protein interaction studies that might indicate novel binding partners

  • Detect unexpected expression patterns during infection that suggest regulatory functions

  • Recognize atypical structural features that don't align with predicted models

  • Flag contradictory experimental results that require further investigation

Implementing machine learning-based anomaly detection can enhance the rigor of data analysis, particularly when working with high-throughput experimental approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.