Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 259R (IIV6-259R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
IIV6-259R; Uncharacterized protein 259R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-299
Protein Length
full length protein
Species
Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus)
Target Names
IIV6-259R
Target Protein Sequence
MTTKHELVINTNEPSAPNADSFYPSYSNETSFSPQYQRDFSGFSGGGMIGEKMATRYEGR TLPRDSLMMIESQSPLNHRKTDFNDKTKTLPVYKNGGYPNLETFKVSRRETDEEEEHFKD YKINKISEYIKYLDTEIKDRERLKKNYGKLDKTLFGVECSCMITELGVTGTSFFIPPMVV ISTPICLGLTVFSTVLRNGSKLITKKIDKHAHIELLAKSKRNSIDEKYTKAMEDGVISES EFQDIRKEIYNYDEMKKSILNQFKNNSQAIELTKEAQLTLINKGKEEMKEEFKIKLNKL
Uniprot No.

Target Background

Database Links

KEGG: vg:1733155

Protein Families
IIV-6 259R family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is known about the structural properties of the IIV6-259R protein?

IIV6-259R is a full-length protein (299 amino acids) derived from Invertebrate iridescent virus 6 (IIV-6), also known as Chilo iridescent virus. The protein can be recombinantly expressed with a histidine tag in E. coli expression systems for purification and characterization purposes . As an uncharacterized protein, its three-dimensional structure has not been fully elucidated through crystallography or cryo-EM methods.

For structural determination, researchers should consider a multi-faceted approach:

  • Primary sequence analysis using bioinformatics tools to predict domains and motifs

  • Secondary structure prediction through circular dichroism (CD) spectroscopy

  • Size-exclusion chromatography to determine oligomeric state

  • X-ray crystallography or NMR spectroscopy for high-resolution structural determination

How should researchers approach expression and purification of IIV6-259R for experimental studies?

The recombinant expression of IIV6-259R requires careful optimization of conditions to ensure proper folding and solubility. Based on available protocols, the following methodological approach is recommended:

  • Vector selection: Use a bacterial expression vector with a His-tag to facilitate purification

  • Expression conditions: Initial screening should test multiple temperatures (16°C, 25°C, 37°C), IPTG concentrations (0.1-1.0 mM), and expression durations (4-24 hours)

  • Lysis and solubilization: Test different buffer compositions with varied pH (6.0-8.5) and salt concentrations (100-500 mM NaCl)

  • Purification strategy: Implement a two-step purification using:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged protein capture

    • Size exclusion chromatography for further purification and buffer exchange

The current expression system utilizes E. coli as the host organism for recombinant production of His-tagged IIV6-259R protein spanning the full length sequence (residues 1-299) .

What experimental approaches can determine the biological function of IIV6-259R in viral replication?

As an uncharacterized protein, determining the biological function of IIV6-259R requires a systematic approach that combines multiple experimental strategies:

  • Viral genetics approach:

    • Generate IIV6 mutants lacking the 259R gene using reverse genetics

    • Assess the impact on viral replication in permissive cell lines

    • Quantify virion production, genome replication, and transcription profiles

  • Localization studies:

    • Express fluorescently tagged IIV6-259R in infected cells

    • Use confocal microscopy to determine subcellular localization during viral replication

    • Perform time-course analysis to identify temporal patterns in localization

  • Protein-protein interaction analysis:

    • Implement affinity purification coupled with mass spectrometry (AP-MS)

    • Validate interactions using co-immunoprecipitation or yeast two-hybrid assays

    • Create an interaction network to identify potential functional pathways

  • Comparative genomics:

    • Analyze homology with characterized proteins from related viruses

    • Identify conserved domains that may suggest functional roles

How can researchers develop robust experimental designs to investigate potential roles of IIV6-259R in host immune evasion?

Investigating IIV6-259R's role in host immune evasion requires a well-structured experimental design with clearly defined variables and controls. Researchers should consider the following methodological framework:

  • Hypothesis development: Formulate a testable hypothesis about IIV6-259R's role based on bioinformatic analysis and preliminary data.

  • Experimental setup:

    • Independent variable: Expression/presence of IIV6-259R protein

    • Dependent variables: Measurable immune responses (cytokine production, pathway activation)

    • Controls: Mock-infected cells, cells infected with IIV6 lacking 259R gene

  • Cell culture models:

    • Select appropriate insect cell lines that support IIV6 replication

    • Consider both continuous cell lines and primary hemocytes

  • Immune response measurements:

    • Quantify changes in innate immune pathway components (NF-κB, JAK/STAT)

    • Assess antimicrobial peptide expression using RT-qPCR

    • Measure reactive oxygen species production

  • Statistical validation:

    • Implement rigorous statistical analysis with appropriate sample sizes

    • Use ANOVA with post-hoc tests to determine significance of observed differences

    • Report effect sizes alongside p-values

This approach follows proper experimental design principles by establishing controlled conditions for objective observations on the effect that the independent variable (IIV6-259R) has on dependent variables (immune responses) .

What methodological approaches can address data contradictions when studying protein-protein interactions involving IIV6-259R?

When studying protein-protein interactions (PPIs) involving uncharacterized proteins like IIV6-259R, researchers often encounter contradictory results between different methodologies. Addressing these contradictions requires a systematic approach:

  • Employ multiple, complementary techniques:

    • Co-immunoprecipitation (Co-IP) with antibodies against native proteins

    • Pull-down assays with recombinant tagged proteins

    • Proximity ligation assays (PLA) for in situ detection of interactions

    • Fluorescence resonance energy transfer (FRET) for dynamic interaction studies

  • Data integration framework:

    • Create a scoring system that weights results based on technique sensitivity and specificity

    • Implement Bayesian analysis to calculate confidence levels for each interaction

    • Triangulate results across methodologies to identify consensus interactions

  • Validation strategy:

    • Perform targeted mutagenesis of predicted interaction domains

    • Assess interaction strength using quantitative methods like surface plasmon resonance

    • Examine functional consequences of disrupted interactions

  • Managing false positives/negatives:

    • Include appropriate positive and negative controls for each method

    • Implement stringent washing conditions in affinity-based methods

    • Use biological replicates with different tags/orientations

  • Standardized reporting:

    • Document all experimental conditions, including buffer compositions

    • Report all attempted validations, including negative results

    • Maintain detailed laboratory notebooks for retrospective analysis

How should researchers design experiments to characterize post-translational modifications of IIV6-259R?

Characterizing post-translational modifications (PTMs) of an uncharacterized protein like IIV6-259R requires careful experimental design with appropriate controls and validation steps:

  • Experimental planning:

    • Express recombinant IIV6-259R in both prokaryotic (E. coli) and eukaryotic (insect cell) systems

    • Compare PTM patterns between systems to identify host-specific modifications

    • Include both virus-infected cells and recombinant expression systems

  • Analytical techniques:

    • Perform high-resolution mass spectrometry with multiple fragmentation methods

    • Use phospho-specific antibodies for targeted detection of phosphorylation

    • Implement enrichment strategies for specific PTMs (phosphopeptide enrichment, glycopeptide capture)

  • Data analysis workflow:

    • Use multiple search algorithms (e.g., MASCOT, SEQUEST) with appropriate FDR controls

    • Validate site localizations using positional scoring methods

    • Quantify modification stoichiometry at each site

  • Functional validation:

    • Generate site-directed mutants at identified PTM sites

    • Assess impact on protein stability, localization, and function

    • Determine enzymes responsible using inhibitor studies or knockdown approaches

This methodological framework allows for comprehensive characterization of PTMs while minimizing false positives through multiple validation steps, following best practices in experimental design that include controlled variables and objective measurements .

What quality control measures are essential when performing structure-function studies of IIV6-259R?

When conducting structure-function studies on an uncharacterized protein like IIV6-259R, implementing robust quality control measures is crucial for reliable results:

  • Protein quality assessment:

    • Verify protein purity using SDS-PAGE and mass spectrometry (>95% purity)

    • Confirm protein identity through peptide mass fingerprinting

    • Assess protein folding using circular dichroism and thermal shift assays

    • Document batch-to-batch variation with standardized analytical methods

  • Experimental design controls:

    • Include positive and negative controls for each functional assay

    • Implement domain deletion and point mutation controls

    • Perform dose-response studies to establish quantitative relationships

  • Data reliability measures:

    • Calculate and report signal-to-noise ratios for all assays

    • Implement technical and biological replicates (minimum n=3)

    • Perform power analysis to determine appropriate sample sizes

    • Document all raw data and analysis methods for reproducibility

  • Validation framework:

    • Confirm key findings using orthogonal techniques

    • Verify structure-function relationships through rescue experiments

    • Implement blinded analysis where applicable to reduce bias

How can researchers effectively analyze contradictory results when studying IIV6-259R interactions with host factors?

When studying interactions between an uncharacterized viral protein like IIV6-259R and host factors, contradictory results often emerge from different experimental approaches. A systematic framework for resolving these contradictions includes:

What statistical approaches are most appropriate for analyzing IIV6-259R expression data across different experimental conditions?

For analyzing IIV6-259R expression across experimental conditions, researchers should implement a rigorous statistical framework that accounts for the specific characteristics of expression data:

  • Experimental design considerations:

    • Implement factorial designs to evaluate multiple variables simultaneously

    • Include appropriate biological and technical replicates (minimum n=3)

    • Plan time-course experiments with sufficient temporal resolution

  • Normalization strategy:

    • Select appropriate reference genes for qPCR normalization

    • Apply global normalization methods for RNA-Seq data

    • Implement internal standards for protein quantification

  • Statistical testing framework:

    • For normally distributed data: Apply ANOVA with appropriate post-hoc tests

    • For non-normally distributed data: Use non-parametric alternatives (Kruskal-Wallis)

    • For time-course data: Implement repeated measures ANOVA or mixed-effects models

  • Multiple testing correction:

    • Apply Benjamini-Hochberg FDR correction for high-throughput data

    • Report both raw and adjusted p-values

    • Implement q-value calculations for large-scale analyses

  • Effect size reporting:

    • Include fold-change measurements with confidence intervals

    • Calculate and report Cohen's d or similar effect size metrics

    • Present data using visualization methods that illustrate both statistical significance and effect magnitude

What are the most effective methods for studying the localization of IIV6-259R during viral infection?

Determining the subcellular localization of IIV6-259R during infection requires a multi-faceted approach that combines complementary imaging and biochemical techniques:

  • Fluorescence microscopy approaches:

    • Immunofluorescence using antibodies against native IIV6-259R

    • Expression of fluorescent protein-tagged IIV6-259R (ensuring tag doesn't disrupt localization)

    • Live-cell imaging to track dynamics throughout the infection cycle

    • Super-resolution microscopy (STED, STORM) for high-precision localization

  • Biochemical fractionation methods:

    • Differential centrifugation to separate cellular compartments

    • Density gradient fractionation for membrane-associated components

    • Western blot analysis of fractions with compartment-specific markers

    • Protease protection assays to determine membrane topology

  • Experimental controls:

    • Include markers for key cellular compartments (nucleus, ER, Golgi, mitochondria)

    • Perform co-localization with viral markers at different infection timepoints

    • Compare wild-type localization with mutant versions lacking targeting signals

  • Quantitative analysis:

    • Implement Pearson's correlation coefficient for co-localization analysis

    • Calculate enrichment factors for each subcellular compartment

    • Perform time-course analysis to identify temporal patterns

This methodological approach provides comprehensive insights into IIV6-259R localization while minimizing artifacts through multiple orthogonal techniques, following experimental design principles that emphasize controlled environments and objective measurements .

What high-throughput screening approaches can identify potential inhibitors of IIV6-259R function?

Identifying inhibitors of an uncharacterized protein like IIV6-259R requires a systematic high-throughput screening approach with robust validation steps:

  • Assay development strategy:

    • Design functional assays based on predicted protein activities

    • Develop binding assays using fluorescence polarization or thermal shift

    • Establish cell-based assays measuring viral replication in the presence of compounds

    • Optimize assay parameters for Z' factor >0.5 to ensure reliability

  • Compound library selection:

    • Natural product libraries (particularly from insect pathogens)

    • FDA-approved drug libraries for repurposing potential

    • Fragment-based libraries for initial binding studies

    • Focused libraries based on bioinformatic predictions

  • Screening workflow:

    • Primary screen at single concentration (10-20 μM)

    • Dose-response confirmation for hits (8-point curves)

    • Counter-screens against related viral proteins to assess specificity

    • Cytotoxicity evaluation in relevant cell lines

  • Validation cascade:

    • Biochemical mechanism-of-action studies

    • Structural studies of compound-protein complexes

    • Resistance mutation studies to confirm target engagement

    • Viral replication assays with IIV6 mutants

  • Data analysis framework:

    • Implement machine learning for structure-activity relationship analysis

    • Perform clustering analysis to identify chemical scaffolds

    • Develop pharmacophore models for hit expansion

This comprehensive approach maximizes the chances of identifying specific inhibitors while minimizing false positives through rigorous validation steps, adhering to principles of true experimental research design with clearly defined variables and controls .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.