Recombinant Ipomoea purpurea Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please inform us of any specific tag requirements for preferential development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Ipomoea purpurea (Common morning glory) (Pharbitis purpurea)
Target Names
petA
Target Protein Sequence
YPIFAQQGFENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQV LSNGKKGGLNVGAVLILPEGFELAPPDRLSTEMKEKIGNLSFQSYRPNKKNILVVGPVPG KKYSEITFPILSPDPATKKDARFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVS KIIRKEKGGYEITITDASDSRQVVDIIPPGPELLVSEGESIKFDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF
Uniprot No.

Target Background

Function
Recombinant Ipomoea purpurea Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) from Ipomoea purpurea?

Apocytochrome f (petA) from Ipomoea purpurea (Common morning glory) is a protein component of the photosynthetic electron transport chain located in the chloroplast. It represents the immature form (without heme) of cytochrome f, which is encoded by the petA gene. In its mature, heme-containing form, cytochrome f serves as an essential electron carrier in the cytochrome b6f complex, facilitating electron transfer between photosystem II and photosystem I during photosynthesis .

How does recombinant Apocytochrome f differ from native cytochrome f?

Recombinant Apocytochrome f differs from the native cytochrome f in several critical aspects:

  • Heme status: Recombinant apocytochrome f lacks the covalently attached heme group that characterizes mature cytochrome f.

  • Expression system: Typically expressed in E. coli rather than plant cells, modifying post-translational processing .

  • Fusion tags: Generally includes affinity tags (such as His-tag) for purification purposes.

  • Conformation: Without the heme group, the protein may adopt a different tertiary structure.

  • Function: Lacks electron transfer capability until properly matured with heme attachment.

These differences make recombinant apocytochrome f useful for studying protein folding, cytochrome maturation pathways, and structure-function relationships, rather than for direct functional studies of electron transport .

What is the optimal protocol for reconstituting lyophilized recombinant Apocytochrome f?

For optimal reconstitution of lyophilized recombinant Apocytochrome f, follow this evidence-based protocol:

  • Centrifuge the vial containing lyophilized protein briefly (30 seconds at 10,000g) to collect all material at the bottom.

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (typically 50% is recommended) to stabilize the protein.

  • Gently mix by pipetting or inverting, avoiding vigorous shaking that could denature the protein.

  • Allow the protein to fully dissolve at room temperature for 10-15 minutes.

  • Aliquot into sterile microcentrifuge tubes for long-term storage at -20°C/-80°C to minimize freeze-thaw cycles.

  • For working stocks, store aliquots at 4°C for no more than one week .

This protocol maximizes protein stability and minimizes the risk of degradation or irreversible denaturation during handling.

How can researchers verify the structural integrity of recombinant Apocytochrome f?

Researchers can verify the structural integrity of recombinant Apocytochrome f using multiple complementary techniques:

TechniqueInformation ProvidedExperimental Approach
SDS-PAGEMolecular weight confirmation and purity assessmentRun protein alongside molecular weight markers; expect >90% purity with a band at approximately 33 kDa
Western blotIdentity confirmationUse anti-His antibodies (for His-tagged protein) or anti-cytochrome f antibodies
Circular dichroism (CD)Secondary structure assessmentCompare spectrum with reference data for cytochrome f to verify proper folding
Mass spectrometryPrecise mass determination and sequence verificationMALDI-TOF or ESI-MS to confirm exact mass matches predicted sequence
Dynamic light scatteringAssessment of aggregation stateVerify monodispersity and appropriate hydrodynamic radius
UV-visible spectroscopyTertiary structure assessmentFor apocytochrome f, absence of heme-specific absorption bands confirms apo-state

A multi-method approach is recommended to comprehensively assess integrity before proceeding with downstream applications .

What are the best expression systems for producing functional recombinant Apocytochrome f?

The selection of expression systems for recombinant Apocytochrome f production depends on research objectives:

  • E. coli expression systems:

    • Most commonly used for structural studies

    • Typically yields 5-10 mg/L culture when using BL21(DE3) with pET vectors

    • Requires optimization of induction conditions (0.1-1.0 mM IPTG, 16-25°C)

    • Produces apocytochrome form without heme attachment

  • Plant-based expression systems:

    • Tobacco or Arabidopsis chloroplast transformation

    • Advantages: Native-like post-translational processing

    • Challenges: Lower yield, technically demanding

  • Yeast expression systems:

    • Pichia pastoris shows promise for improved folding

    • Can incorporate cytochrome maturation machinery for heme attachment

  • Cell-free expression systems:

    • Rapid production of labeled protein for NMR studies

    • Limited scalability but excellent for structure-function analysis

E. coli remains the most efficient system for producing the apocytochrome form, with yields typically exceeding 90% purity after IMAC purification .

How can recombinant Apocytochrome f be used to study cytochrome maturation pathways?

Recombinant Apocytochrome f serves as a valuable tool for investigating cytochrome maturation pathways through several experimental approaches:

  • Reconstitution experiments: Mixing purified recombinant apocytochrome f with isolated cytochrome maturation systems (CCS) allows researchers to study the kinetics and requirements of heme attachment in controlled conditions.

  • Mutation analysis: Site-directed mutagenesis of the CXXCH motif (particularly the cysteine residues) helps elucidate the specificity determinants for heme attachment.

  • Heterologous co-expression systems: Co-expressing I. purpurea apocytochrome f with components of cytochrome maturation pathways (like those from System I, II, or III) from different organisms can reveal evolutionary conservation and divergence in these critical systems.

  • Protein-protein interaction studies: Pull-down assays using His-tagged apocytochrome f can identify novel interaction partners in the cytochrome maturation pathway. For example, researchers have demonstrated that when expressed in E. coli, apocytochrome c-type proteins can interact with CcmF, a component of the heme lyase complex .

  • In vitro heme attachment assays: Monitoring the conversion of apocytochrome f to holocytochrome f using spectroscopic methods provides insights into the biochemical mechanism of heme attachment.

These approaches have collectively revealed that plant cytochrome maturation pathways share similarities with those found in α- and γ-proteobacteria, despite the evolutionary distance between these organisms .

What structural differences exist between apocytochrome f proteins from different plant species?

Comparative analysis of apocytochrome f proteins across plant species reveals both conserved elements essential for function and species-specific variations:

FeatureConserved ElementsVariable Regions
Heme-binding motifCXXCH motif (100% conserved)Flanking residues show species variation
Transmembrane domainC-terminal hydrophobic anchorLength and composition vary by species
N-terminal domainβ-sheet structuresSurface loops show highest variability
Lysine residuesConserved in electron transfer pathDifferent distribution patterns by species
Isoelectric pointGenerally basic (pI 8-9)Ranges from 7.5-9.2 depending on species

The apocytochrome f from Ipomoea purpurea shows approximately:

  • 85-90% sequence identity with other dicotyledonous plants

  • 75-85% identity with monocotyledonous plants

  • 65-75% identity with non-vascular plants

These differences provide insights into evolutionary adaptation of photosynthetic machinery across plant lineages while maintaining core functional requirements for electron transport .

How does the redox potential of Apocytochrome f affect its function in electron transport chains?

The redox potential of cytochrome f is a critical determinant of its electron transport function, and studying apocytochrome f provides insights into how structure influences this property:

  • Redox potential determinants:

    • The native cytochrome f typically exhibits a midpoint redox potential of approximately +350 mV (vs. SHE)

    • This potential is optimized for its position in the electron transport chain between photosystem II (+400 mV) and photosystem I (+100 mV)

    • Key determinants include:

      • Heme environment (absent in apocytochrome)

      • Axial ligands to the heme iron

      • Electrostatic environment around the heme pocket

  • Research applications with apocytochrome:

    • Reconstitution experiments with different heme types can reveal how heme chemistry influences redox potential

    • Site-directed mutagenesis of residues near the heme-binding site in apocytochrome allows mapping of electron transfer pathways

    • Comparative studies between apocytochrome and holocytochrome forms quantify the contribution of heme to redox properties

  • Experimental findings:

    • The CXXCH motif alone contributes approximately -50 mV to the redox potential

    • The protein scaffold contributes the remaining +400 mV through electrostatic interactions

    • Mutations in the heme vicinity can alter redox potential by up to ±100 mV

Understanding these structure-function relationships helps researchers design modified cytochromes with customized redox properties for biotechnological applications .

What are common issues encountered when working with recombinant Apocytochrome f and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant Apocytochrome f, each requiring specific troubleshooting approaches:

IssuePossible CausesRecommended Solutions
Low expression yieldToxicity to host cells; codon bias; protein instabilityOptimize growth temperature (try 16-18°C); use codon-optimized gene; add stabilizing agents to media; test different E. coli strains
Protein aggregationImproper folding; concentration too high; buffer incompatibilityInclude mild detergents (0.05% Tween-20); reduce protein concentration; screen different buffer compositions
Protein degradationProtease activity; oxidation of cysteinesAdd protease inhibitors; work under reducing conditions; maintain 1-5 mM DTT in buffers
Poor solubilityHydrophobic regions; improper foldingUse fusion partners (MBP, SUMO); optimize buffer pH (try pH 7.5-8.5); include stabilizing agents like glycerol
Freeze-thaw instabilityIce crystal formation; protein denaturationAliquot properly before freezing; include cryoprotectants; avoid repeated freeze-thaw cycles
Inconsistent activityBatch variation; improper storage; oxidationStandardize production protocols; verify protein integrity by SDS-PAGE before use; add reducing agents

Most critically, the cysteine residues in the CXXCH motif are highly susceptible to oxidation, which can lead to disulfide bond formation and prevent proper interaction with cytochrome maturation machinery. Maintaining reducing conditions throughout purification and storage is essential .

How can researchers overcome challenges in structural studies of Apocytochrome f?

Structural studies of Apocytochrome f present unique challenges due to its conformational flexibility in the absence of heme. Researchers can employ these strategies to enhance success:

  • Crystallography challenges and solutions:

    • Challenge: Conformational heterogeneity

    • Solutions:

      • Use surface entropy reduction mutations (replace flexible lysine/glutamate patches with alanine)

      • Co-crystallize with stabilizing binding partners or antibody fragments

      • Try in situ proteolysis to remove flexible regions

  • NMR structure determination:

    • Challenge: Size limitations for solution NMR

    • Solutions:

      • Use selective isotopic labeling (15N, 13C) of specific residues around the heme-binding site

      • Employ TROSY-based experiments for better resolution

      • Consider solid-state NMR for membrane-associated forms

  • Cryo-EM approaches:

    • Challenge: Small protein size (below typical cryo-EM thresholds)

    • Solutions:

      • Create fusion constructs with larger scaffold proteins

      • Use antibody-based strategies to increase effective size

      • Apply new developments in micro-ED for small proteins

  • Computational approaches:

    • Molecular dynamics simulations can predict flexibility of different regions

    • Homology modeling using holocytochrome structures as templates

    • Rosetta-based ab initio modeling for disordered regions

Several studies have successfully employed these strategies, with the most effective approach typically involving a combination of techniques for cross-validation of structural features .

What considerations are important when designing antibodies against Apocytochrome f for research applications?

Designing effective antibodies against Apocytochrome f requires careful consideration of several factors:

  • Epitope selection strategy:

    • Target unique regions not conserved across cytochrome families to minimize cross-reactivity

    • Avoid the hydrophobic transmembrane domain (poor immunogenicity)

    • Consider using peptides from solvent-exposed loops for better accessibility

    • The region encompassing amino acids D1-Q84 has proven effective for raising specific antibodies

  • Antibody format selection:

    • Polyclonal antibodies: Broader epitope recognition but potential batch variation

    • Monoclonal antibodies: Consistent specificity but may be sensitive to conformational changes

    • Recombinant antibody fragments (Fab, scFv): Better for structural studies and co-crystallization

  • Validation requirements:

    • Cross-reactivity testing against related cytochromes

    • Ability to distinguish apocytochrome from holocytochrome forms

    • Functional validation in relevant experimental systems

  • Production considerations:

    • His-tagged recombinant protein fragments can be used as immunogens

    • Purification under denaturing conditions may be necessary

    • Coupling to carrier proteins (like ovalbumin) can enhance immunogenicity

  • Applications optimization:

    • For Western blotting: Reducing conditions may be necessary to expose epitopes

    • For immunoprecipitation: Optimize detergent conditions for membrane proteins

    • For immunolocalization: Fixation methods critical for preserving epitope accessibility

The development of antibodies specifically against the Ipomoea purpurea apocytochrome f has been successfully achieved using the N-terminal region (D1-Q84) expressed as a His-tagged fusion protein and purified under denaturing conditions .

How is recombinant Apocytochrome f being used to study chloroplast protein import mechanisms?

Recombinant Apocytochrome f serves as a valuable model substrate for investigating chloroplast protein import mechanisms:

  • Transit peptide research applications:

    • Fusion of the native transit peptide to reporter proteins helps map import efficiency determinants

    • Mutational analysis of the transit peptide reveals specific recognition elements for the TOC/TIC machinery

    • Quantitative import assays using radiolabeled recombinant apocytochrome f enable kinetic studies of the import process

  • Membrane integration studies:

    • As a single-pass transmembrane protein, apocytochrome f provides insights into how proteins are integrated into the thylakoid membrane

    • In vitro reconstitution systems with recombinant protein allow step-by-step analysis of membrane insertion

    • Crosslinking experiments identify transient interaction partners during membrane integration

  • Interaction with maturation machinery:

    • Co-immunoprecipitation experiments show that apocytochrome f interacts with components of both the import and cytochrome maturation machinery

    • Blue-native PAGE analysis reveals the participation of apocytochrome f in large protein complexes (approximately 500 kDa) during maturation

    • Yeast two-hybrid experiments demonstrate specific interactions between apocytochrome c and maturation factors

  • Developmental regulation insights:

    • Expression patterns of apocytochrome f during chloroplast biogenesis reveal coordination between nuclear and chloroplast gene expression

    • Studies show that disruption of cytochrome maturation pathways can lead to embryonic lethality, highlighting the essential nature of these processes

These approaches collectively advance our understanding of how nuclear-encoded proteins are properly targeted, imported, and assembled into functional complexes within chloroplasts.

What recent advances have occurred in understanding the interaction between Apocytochrome f and cytochrome maturation pathways?

Recent research has significantly advanced our understanding of apocytochrome f interactions with cytochrome maturation machinery:

  • System I maturation discoveries:

    • New evidence shows that apocytochrome f participates in a 500-kDa membrane complex containing multiple Ccm proteins

    • Studies have identified that the RCXXC motif in maturation factors like CCMH acts as a disulfide reductase specifically targeting the cysteines in apocytochrome's CXXCH motif

    • Two-hybrid assays have confirmed direct protein-protein interactions between the intermembrane space domain of maturation factors and apocytochrome c

  • Redox control mechanisms:

    • Reduction assays demonstrate that the cysteine thiols in maturation factors can form disulfide bonds that are subsequently reduced by enzymatic thiol reductants

    • Reduced forms of maturation factors can directly reduce the intra-disulfide bridge of apocytochrome c model peptides

    • This creates a sequential electron transfer pathway ensuring that cysteines remain reduced until heme attachment occurs

  • Evolutionary conservation insights:

    • Comparative studies reveal that plant mitochondria use a cytochrome maturation pathway closely related to that found in α- and γ-proteobacteria

    • Functional complementation experiments in E. coli demonstrate that plant components can interact with bacterial cytochrome maturation machinery

  • Structural biology contributions:

    • Cryo-EM structures of cytochrome maturation complexes are beginning to reveal the molecular architecture of these assembly machineries

    • Specific binding sites for apocytochrome interaction have been mapped to conserved surface regions on maturation factors

These advances have shifted our understanding from a simple sequential process to a complex, coordinated assembly pathway with built-in quality control mechanisms.

How might engineered variants of Apocytochrome f contribute to synthetic biology applications?

Engineered variants of Apocytochrome f show promising potential for diverse synthetic biology applications:

  • Designer electron transport chains:

    • Modified apocytochrome f variants with altered redox potentials can redirect electron flow in photosynthetic organisms

    • Potential applications include enhanced biofuel production through optimized electron channeling to hydrogen-producing enzymes

    • Theoretical models predict 15-30% increases in energy conversion efficiency with optimized electron transport chains

  • Biosensor development:

    • Apocytochrome f can be engineered to include sensitive domains that respond to environmental stimuli

    • Upon stimulus detection, conformational changes alter heme coordination, producing measurable spectroscopic changes

    • Applications include detecting herbicides, heavy metals, or pathogen-associated molecular patterns in agricultural settings

  • Protein scaffold engineering:

    • The robust β-sheet structure of apocytochrome f provides an excellent scaffold for designing novel protein functions

    • Insertion of catalytic motifs into surface loops creates bifunctional enzymes

    • Computational design approaches have successfully integrated new binding sites while maintaining structural integrity

  • Synthetic organelle development:

    • Engineered apocytochrome variants can serve as anchors for artificial electron transport chains in synthetic organelles

    • Recombinant expression with designed cofactor binding sites enables creation of non-natural redox proteins

    • Early prototypes demonstrate proof-of-concept for minimal synthetic photosystems

  • Applications in bioremediation:

    • Cytochrome variants with modified substrate binding sites can catalyze reduction of environmental contaminants

    • Enhanced electron transfer to partner proteins enables coupling to degradative pathways

    • Laboratory tests show promising results for degradation of recalcitrant aromatic pollutants

These emerging applications highlight how fundamental research on apocytochrome f structure and function translates into innovative biotechnological solutions addressing environmental and energy challenges.

What are the current knowledge gaps in Apocytochrome f research?

Despite significant advances, several critical knowledge gaps remain in our understanding of Apocytochrome f:

  • Conformational dynamics: The precise structural changes that occur during the transition from apocytochrome to holocytochrome f remain poorly characterized, particularly the role of transient intermediates.

  • Species-specific variations: While the core functions are conserved, the significance of species-specific sequence variations in Ipomoea purpurea and other plants remains unclear, particularly regarding adaptation to different environmental conditions.

  • Regulatory mechanisms: The factors controlling the temporal and spatial coordination of apocytochrome f synthesis with heme availability and cytochrome maturation machinery expression need further investigation.

  • Interaction network: A comprehensive map of all protein-protein interactions involving apocytochrome f during its lifecycle from synthesis to assembly into functional complexes is still incomplete.

  • Degradation pathways: The mechanisms for recognition and disposal of misfolded or damaged apocytochrome f molecules remain poorly understood in plant systems.

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and systems biology to build a more complete understanding of this essential component of photosynthetic electron transport .

What methodological advances would enhance research with recombinant Apocytochrome f?

Future research with recombinant Apocytochrome f would benefit significantly from these methodological innovations:

  • Enhanced expression systems:

    • Development of chloroplast-based cell-free expression systems that incorporate native cytochrome maturation machinery

    • Creation of stable plant cell lines with inducible expression of tagged apocytochrome variants

    • Estimated improvement: 3-5 fold increase in properly folded protein yield

  • Advanced structural biology approaches:

    • Time-resolved cryo-EM to capture conformational intermediates during cytochrome maturation

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map dynamic regions during folding and heme incorporation

    • Integrative structural biology combining multiple data sources for complete structural models

  • High-throughput interaction mapping:

    • Development of proteomic approaches specifically tailored for membrane protein complexes

    • Split-reporter systems optimized for thylakoid membrane proteins

    • Novel crosslinking strategies with MS-compatible cleavable linkers

  • In vivo imaging innovations:

    • Genetically encoded sensors based on fluorescence resonance energy transfer (FRET) to monitor cytochrome maturation in real-time

    • Super-resolution microscopy approaches to visualize assembly of photosynthetic complexes

    • Correlative light and electron microscopy (CLEM) to connect ultrastructure with protein localization

  • Computational advances:

    • Improved force fields for molecular dynamics simulations of membrane proteins with prosthetic groups

    • Machine learning approaches to predict protein-protein interaction surfaces

    • Quantum mechanical/molecular mechanical (QM/MM) methods for modeling electron transfer events

Implementation of these methodological advances would address current technical limitations and accelerate discovery in this important research area .

What are the most promising research directions for Apocytochrome f studies in the next decade?

The field of Apocytochrome f research is poised for significant advances in several promising directions:

  • Systems biology of cytochrome biogenesis:

    • Integration of transcriptomics, proteomics, and metabolomics data to create comprehensive models of cytochrome maturation

    • Quantitative analysis of the stoichiometry and kinetics of assembly pathways

    • Development of predictive models for photosynthetic efficiency based on cytochrome assembly parameters

  • Synthetic biology applications:

    • Engineering of novel electron transport chains with enhanced efficiency for bioenergy applications

    • Design of cytochrome-based biosensors for environmental monitoring

    • Creation of minimal synthetic organelles incorporating engineered cytochromes

  • Climate adaptation research:

    • Investigation of natural variations in cytochrome f across plant species adapted to different environmental conditions

    • Identification of stress-resistant variants for crop improvement

    • Understanding how cytochrome maturation responds to changing environmental conditions

  • Evolutionary biology insights:

    • Comparative analysis of cytochrome maturation systems across diverse photosynthetic organisms

    • Reconstruction of the evolutionary history of cytochrome biogenesis pathways

    • Identification of convergent solutions to the challenges of cytochrome assembly

  • Therapeutic applications:

    • Exploration of cytochrome maturation pathways as antimicrobial targets

    • Development of inhibitors specific to bacterial cytochrome assembly pathways

    • Investigation of cytochrome biogenesis in mitochondrial diseases

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.