Recombinant Ipomoea purpurea ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Functional Domains

The protein contains conserved motifs critical for proton translocation and interaction with the c-ring rotor. These include:

  • Transmembrane Helices: Predicted to form a channel for proton movement across the thylakoid membrane .

  • Proton-Binding Sites: Residues interacting with c-subunits during ATP synthesis .

Mechanism of Action

The atpI subunit (subunit a) forms part of the F₀ sector, which couples proton motive force (PMF) to ATP synthesis. Key roles include:

  1. Proton Translocation: Facilitates the movement of protons through the thylakoid membrane, driving the rotation of the c-ring rotor .

  2. c-Ring Stabilization: Interacts with the c-subunits to prevent proton short-circuiting and regulate rotor assembly .

  3. Regulatory Interactions: Modulates ATP synthase activity through conformational changes and phosphorylation events .

Phylogenetic Conservation

The atpI gene is encoded in the chloroplast genome of Ipomoea species, as shown in comparative genomic studies . Sequence analysis reveals high similarity to homologs in Ipomoea nil (99.0%) and other morning glories, underscoring its conserved function in plant energy metabolism .

Cloning and Expression

The atpI gene has been cloned via RT-PCR from Ipomoea purpurea cDNA, followed by expression in E. coli systems . Key findings include:

ParameterObservationSource
Expression HostE. coli BL21(DE3) ,
Induction ConditionsIPTG concentrations (0.1–2 mM) at 18°C for optimal yield
Yield~50–100 µg purified protein per batch
PurificationAffinity chromatography (His-tag) followed by SDS-PAGE validation ,

Functional Studies

  • Rotor Assembly: Deletion of atpI in bacterial systems disrupts c-ring stability and ATP synthase activity, though full functionality may depend on organism-specific chaperones .

  • Growth Impact: In alkaliphilic Bacillus, atpI deletion reduces ATPase activity and malate-driven growth, highlighting its role in proton-coupled ATP synthesis .

Applications in Research

  1. Enzyme Assays: Used to study proton translocation kinetics and ATP synthesis mechanisms .

  2. Phylogenetic Markers: atpI sequence variations aid in distinguishing I. purpurea from closely related species (e.g., I. nil) .

  3. Biotechnological Tools: Recombinant atpI serves as a model for engineering bioenergy systems or studying alkaliphilic ATP synthases .

Comparative Analysis with Other Species

OrganismUniProt IDAA LengthKey FeatureSource
Ipomoea purpureaA7Y3B0247Chloroplastic, His-tagged recombinant
Atropa belladonnaP69371247His-tagged, E. coli-expressed
Vibrio choleraePartialCell-free expression system
Bacillus pseudofirmusCritical for c-ring stability in alkaliphiles

Challenges and Future Directions

  • Structural Elucidation: High-resolution structures of plant atpI remain limited, necessitating cryo-EM or crystallography studies .

  • Functional Specialization: Determining how Ipomoea atpI adapts to environmental stressors (e.g., pH variations) could inform agricultural biotechnology .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be decided during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag based on your request.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Ipomoea purpurea (Common morning glory) (Pharbitis purpurea)
Target Names
atpI
Target Protein Sequence
MDVLSCSINTLKGLYDISGVEVGQHFYWQIGGGQVHGQVLITSWVVIAILLGSATIAVRN PQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTIFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSLAYFYAGLSKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMLLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the physiological role of ATP synthase subunit a (atpI) in chloroplasts?

ATP synthase subunit a in chloroplasts functions as an integral membrane component of the F₀ sector of the ATP synthase complex. It plays a critical role in proton translocation across the thylakoid membrane, which is essential for the chemiosmotic mechanism of ATP synthesis. In Ipomoea purpurea, as in other plants, the chloroplastic atpI is involved in creating the proton channel that allows H⁺ ions to flow down their electrochemical gradient, thereby driving ATP synthesis during photosynthesis . The subunit contains transmembrane helices that form part of the proton conduction pathway, with specific conserved amino acid residues that are crucial for proton translocation efficiency.

How does atpI from Ipomoea purpurea compare structurally with other plant species?

Chloroplastic ATP synthase subunit a (atpI) shows considerable conservation across plant species while maintaining species-specific variations. Based on comparative analysis with other plant atpI proteins such as those from Arabidopsis thaliana, Chlamydomonas reinhardtii, and Barbarea verna, the Ipomoea purpurea atpI likely maintains the conserved functional domains characteristic of F₀ sector subunit a proteins . These typically include:

FeatureCharacteristicFunction
Transmembrane domains5-6 hydrophobic alpha-helicesMembrane anchoring and proton channel formation
Conserved arginine residueUsually in the 4th transmembrane segmentCritical for proton translocation
C-terminal domainRelatively conserved across speciesInteraction with other ATP synthase subunits
N-terminal regionMore variable between speciesMay confer species-specific regulatory functions

Sequence alignment analysis would likely reveal 80-90% similarity with other flowering plant atpI proteins, with higher conservation in the transmembrane and functional domains.

What expression systems are most suitable for recombinant Ipomoea purpurea atpI production?

For successful expression of recombinant chloroplastic atpI from Ipomoea purpurea, several expression systems can be considered, each with distinct advantages:

Yeast expression systems represent a middle ground, offering eukaryotic post-translational processing capabilities while maintaining reasonable yields. For chloroplastic proteins like atpI, the methylotrophic yeast Pichia pastoris has demonstrated success with other similar membrane proteins.

What experimental design is most appropriate for evaluating recombinant atpI functionality?

A randomized block design is particularly suitable for evaluating recombinant atpI functionality. This approach helps control for variables that might affect experimental outcomes, such as protein batch variations, experimental day effects, or equipment differences .

Design ElementImplementationRationale
Blocking variableExpression batchControls for variation in protein quality between preparations
Treatment groupsWild-type atpI, mutant variants, control proteinsAllows direct comparison of functional differences
ReplicatesMinimum 3-5 per treatment-block combinationEnsures statistical power for detecting differences
ControlsNon-functional atpI mutant, empty vectorEstablishes baselines for negative and background activity

This design would be implemented as follows:

  • Create multiple batches of protein expression (blocks)

  • Within each batch, express wild-type atpI, mutant variants, and controls

  • Randomly assign order of functional testing within each batch

  • Analyze data using two-way ANOVA to account for both treatment and block effects

This approach minimizes the confounding effects of batch-to-batch variation while optimizing the ability to detect true functional differences between atpI variants.

How should researchers purify recombinant atpI to maintain structural integrity?

Purification of recombinant chloroplastic atpI from Ipomoea purpurea requires specialized protocols to maintain the structural integrity of this membrane protein:

  • Gentle solubilization using mild detergents is essential. n-Dodecyl β-D-maltoside (DDM) or digitonin are preferred for maintaining native folding of chloroplastic membrane proteins. Harsh detergents like SDS should be avoided unless denaturing conditions are acceptable for downstream applications.

  • Affinity chromatography using histidine tags is typically effective, with yields of ≥85% purity achievable as determined by SDS-PAGE . A two-step purification strategy is recommended:

    Purification StepMethodBuffer Composition
    Initial captureIMAC (Ni-NTA)20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.05% DDM, 20-250 mM imidazole gradient
    Secondary purificationSize exclusion20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.05% DDM
  • Temperature control is critical throughout the purification process. All steps should be performed at 4°C to prevent protein degradation and aggregation.

  • Addition of lipids (preferably chloroplast lipid extracts) during or immediately after purification can help stabilize the protein structure and maintain functionality.

  • Avoid freeze-thaw cycles, as these can significantly reduce the structural integrity and activity of membrane proteins like atpI.

What methods can be used to assess the proper folding of recombinant atpI?

Assessing proper folding of recombinant atpI is crucial for ensuring functional studies yield reliable results. Multiple complementary techniques should be employed:

  • Circular Dichroism (CD) Spectroscopy: CD spectra in the far-UV range (190-250 nm) can confirm the presence of secondary structure elements. Properly folded atpI should show characteristic α-helical patterns with negative peaks at 208 and 222 nm, consistent with its transmembrane helical structure.

  • Limited Proteolysis: Properly folded proteins show distinct proteolytic patterns compared to misfolded versions. Time-course digestion with proteases like trypsin or chymotrypsin followed by SDS-PAGE analysis can reveal structural integrity.

  • Thermal Shift Assays: Using fluorescent dyes like SYPRO Orange that bind to exposed hydrophobic regions can help determine protein stability and folding status across a temperature gradient.

  • Binding Assays: Interaction studies with known binding partners from the ATP synthase complex (particularly other F₀ subunits) can indicate proper tertiary structure formation.

  • Reconstitution into Liposomes: Functional reconstitution into liposomes followed by proton translocation assays provides the most direct evidence of proper folding and functionality.

How do site-specific mutations in Ipomoea purpurea atpI affect proton translocation efficiency?

Site-directed mutagenesis of key residues in atpI provides valuable insights into structure-function relationships within the proton channel. Based on ATP synthase research, several critical residues would be primary targets for mutation studies:

  • The conserved arginine residue (typically Arg210 in many species) is essential for proton translocation. Mutation to lysine often preserves some function, while mutation to neutral amino acids like alanine abolishes activity . These mutations would allow researchers to quantify the precise contribution of positive charge positioning to proton channel function.

  • Mutations in the transmembrane helices that line the proton pathway can alter the efficiency of proton translocation. A systematic alanine-scanning approach of these regions would reveal:

    Mutation TypeExpected EffectMeasurement Method
    Polar to nonpolarDisruption of H-bonding networkProton pumping assay in liposomes
    Charge alterationsChanges in proton affinityPatch-clamp electrophysiology
    Helix-breaking (Pro, Gly)Structural destabilizationCD spectroscopy + functional assays
  • Mutations at the interface with c-ring subunits can affect rotational coupling. These would be expected to reduce ATP synthesis efficiency without completely abolishing proton translocation.

Quantitative analysis of proton translocation rates using pH-sensitive fluorescent dyes in reconstituted liposomes provides the most direct measurement of how specific mutations affect atpI function.

What is the role of atpI in supercomplexes formation in chloroplast membranes?

The chloroplastic ATP synthase subunit a (atpI) likely contributes to supercomplex formation through specific protein-protein and protein-lipid interactions in thylakoid membranes. While direct evidence for Ipomoea purpurea is limited, research on related plant systems suggests:

  • AtpI may contain specific interaction domains that facilitate association with other photosynthetic complexes, particularly photosystem I (PSI) in stromal lamellae regions.

  • The subunit likely participates in interactions with CURVATURE THYLAKOID1 (CURT1) proteins, which are involved in thylakoid membrane architecture regulation.

  • AtpI positioning may contribute to the segregation of ATP synthase preferentially to non-appressed regions and stromal lamellae.

To investigate these supercomplex associations, researchers should consider:

  • Blue-native PAGE combined with second-dimension SDS-PAGE to isolate and identify intact supercomplexes

  • Crosslinking mass spectrometry to map specific interaction sites

  • Cryo-electron microscopy for structural analysis of supercomplexes

  • FRET-based approaches to study dynamic associations in reconstituted systems

The lipid composition surrounding atpI is also critical, with particular attention to galactolipids which predominate in thylakoid membranes and may mediate protein-protein interactions.

How does the structure-function relationship of atpI differ between C3 and C4 plant species?

The structure-function relationship of ATP synthase subunit a (atpI) likely varies between C3 plants (like Arabidopsis thaliana) and C4 plants (which might include some Ipomoea species) due to differences in chloroplast types and photosynthetic demands:

  • C4 plants contain dimorphic chloroplasts (bundle sheath and mesophyll), which may exhibit different ATP synthase compositions or regulatory mechanisms. The atpI subunit may show tissue-specific isoforms or post-translational modifications in C4 plants.

  • ATP demand differences between C3 and C4 photosynthesis could drive adaptations in the proton channel properties of atpI:

    ParameterC3 PlantsC4 PlantsMethodological Approach
    Proton translocation rateStandard baselinePotentially higherpH-sensitive fluorescent probes
    pH optimumTypically ~8.0May show broader rangeActivity assays across pH gradient
    Regulatory sitesStandard phosphorylationMay have additional sitesMass spectrometry phosphoproteomic analysis
  • Sequence analysis of atpI from multiple C3 and C4 species, including various Ipomoea species, could reveal adaptive mutations that correlate with photosynthetic mechanism.

  • Expression levels and stoichiometry of atpI relative to other ATP synthase subunits might differ between C3 and C4 plants to accommodate different energetic requirements.

Research approaches should include comparative structural biology, site-directed mutagenesis of differentially conserved residues, and functional reconstitution studies under conditions mimicking the respective chloroplast environments.

How can researchers address solubility issues when expressing recombinant chloroplastic atpI?

Solubility challenges represent a significant hurdle when working with chloroplastic membrane proteins like atpI. Several strategies can be implemented to overcome these issues:

  • Fusion Tags Selection: Beyond standard histidine tags, consider using solubility-enhancing fusion partners:

    Fusion PartnerAdvantagesConsiderations
    MBP (Maltose Binding Protein)Highly soluble, affinity purificationLarge size (43 kDa)
    SUMOEnhances solubility, removableRequires specific protease
    MisticMembrane protein expression enhancerWorks well for bacterial systems
    GFPFolding indicator, solubility enhancementMay affect function, large size
  • Expression Conditions Optimization:

    • Reduce expression temperature to 16-20°C

    • Use slower induction with reduced IPTG concentrations (0.1-0.5 mM)

    • Consider auto-induction media for gradual protein expression

    • Evaluate specialized E. coli strains like C41(DE3) or C43(DE3) specifically designed for membrane protein expression

  • Co-expression with Chaperones:

    • GroEL/GroES system

    • DnaK/DnaJ/GrpE system

    • Specialized membrane protein chaperones

  • Cell-Free Expression Systems:

    • Allow direct incorporation into lipid nanodiscs or detergent micelles

    • Avoid inclusion body formation entirely

    • Enable rapid screening of detergent and buffer conditions

If inclusion bodies form despite these measures, optimize refolding protocols using gradual dialysis with carefully selected detergent mixtures and decreasing concentrations of mild denaturants like urea.

What statistical approaches are appropriate for analyzing atpI functional data?

  • For comparing activity between wild-type and mutant variants, a randomized block ANOVA is recommended . This approach accounts for batch-to-batch variation while focusing on treatment effects:

    F=MStreatmentsMSerrorF = \frac{MS_{treatments}}{MS_{error}}

    Where MS represents mean squares for treatments and error.

  • When evaluating proton translocation kinetics, nonlinear regression models should be applied to determine parameters like:

    • Maximum proton translocation rate (Vmax)

    • Half-maximal effective proton concentration (K0.5)

    • Hill coefficient for cooperativity

  • For thermostability comparisons, Boltzmann sigmoidal curve fitting provides the most appropriate model:

    Y=Bottom+TopBottom1+e(TmX)/SlopeY = Bottom + \frac{Top - Bottom}{1 + e^{(Tm-X)/Slope}}

    Where Tm represents the melting temperature.

  • Power analysis should be conducted before designing experiments to determine appropriate sample sizes. For typical atpI functional studies, achieving 80% power at α=0.05 usually requires:

    • Minimum n=3 biological replicates

    • 3-5 technical replicates per biological replicate

    • Positive and negative controls in each experimental run

  • When comparing atpI variants across multiple conditions (pH, temperature, lipid composition), multifactorial ANOVA followed by appropriate post-hoc tests (Tukey HSD or Bonferroni-corrected t-tests) should be employed to control for multiple comparisons.

How can researchers distinguish between expression and functional issues when troubleshooting recombinant atpI experiments?

Distinguishing between expression problems and functional defects is crucial when working with recombinant chloroplastic atpI. A systematic approach involves:

  • Expression Verification Checkpoints:

    • Western blotting with antibodies against the protein tag and, if available, against atpI itself

    • Mass spectrometry confirmation of expressed protein sequence

    • N-terminal sequencing to verify correct processing

    • Yield quantification across different expression conditions

  • Protein Quality Assessment:

    • Size exclusion chromatography profiles to detect aggregation

    • Dynamic light scattering to evaluate homogeneity

    • Thermal shift assays to assess stability

    • CD spectroscopy to confirm secondary structure composition

  • Functional Analysis Decision Tree:

    ObservationPotential CauseVerification Method
    Low protein yield, correct sizeExpression issueOptimize expression conditions, change host system
    High yield, unexpected sizeProteolysis or incomplete translationWestern blot with N- and C-terminal antibodies, add protease inhibitors
    High yield, correct size, no functionFolding problemCD spectroscopy, limited proteolysis
    Activity in detergent but not in liposomesReconstitution issueTry different lipid compositions, reconstitution methods
    Activity dependent on expression systemPost-translational modification requirementsTest expression in eukaryotic systems, analyze PTMs
  • Control Experiments:

    • Express and analyze a well-characterized membrane protein in parallel

    • Include other ATP synthase subunits as reference points

    • Use known functional mutants as benchmarks

    • Test activity of the entire ATP synthase complex with and without recombinant atpI

By systematically ruling out expression issues before investigating functional problems, researchers can more efficiently troubleshoot experiments involving recombinant Ipomoea purpurea atpI.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.