Recombinant Ipomoea purpurea Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

General Information

CemA refers to the Chloroplast Envelope Membrane protein. Creative BioMart offers a Recombinant Full Length Nephroselmis olivacea Chloroplast Envelope Membrane Protein(CemA) Protein, His-Tagged .

  • Synonyms Gene Name: cemA; Synonyms: cemA; Chloroplast envelope membrane protein

  • Source E. coli

  • Species Nephroselmis olivacea (Green alga)

Chloroplast Genome Organization

Chloroplast (cp) genomes from six Ipomoea species (I. nil, I. purpurea, I. triloba, I. lacunosa, I. hederacea, and I. hederacea var. integriuscula) have been sequenced, revealing complete circular cp genomes of 161,354–161,750 bp with 384–611× coverage . These genomes have a quadripartite structure, including a pair of inverted repeats (IRs) of 61,220–62,122 bp, separated by a large single-copy (LSC) region of 87,579–88,134 bp and a small single-copy (SSC) region of 12,039–12,101 bp .

The six Ipomoea cp genomes exhibit similar GC content, with higher GC content in the IR regions (41%) than in the single-copy regions (LSC, 36%; SSC, 32%), which aligns with other reported cp genomes . Each genome contains 112 unique genes, including 78 protein-coding genes and 30 transfer RNAs, with 17 duplicated genes . Seventeen genes contain introns, with fourteen having a single intron and two (ycf3 and clpP) having two introns . The genes psbL and ndhD use ACG as an alternative start codon, while rps19 starts with GTG, which is common in land plant cp genomes .

Function and Localization

Chloroplast development and integration within a plant cell depend on biochemical machinery within the envelope membranes . Proteomic analysis has identified over 100 proteins in Arabidopsis chloroplast envelope membranes, with about 80% likely located in the chloroplast envelope . These proteins are involved in:

  • Ion and metabolite transport

  • Protein import machinery

  • Chloroplast lipid metabolism

Impact of Protein Overexpression

Overexpression of certain proteins can modulate chloroplast membrane structure . For example, overexpression of the transmembrane (TM) domain of chloroplast unusual positioning protein 1 (CHUP1)–GFP leads to membrane protrusions of the outer envelope, similar to those seen with full-length CHUP1–GFP constructs . Overexpression of the outer envelope protein of 7 kDa (OEP7) as a GFP construct also results in punctate protrusions, suggesting that increased concentration of envelope proteins can alter the outer envelope structure .

Tables of Chloroplast Genome Information

The following tables summarize data regarding the chloroplast genomes of various Ipomoea species.

Table 1. Characteristics of Ipomoea Chloroplast Genomes

SpeciesI. nilI. purpureaI. hederaceaI. hederacea var. integriusculaI. lacunosaI. triloba
Accession numberMG973745MG973746MG973747MG973748MG973749MG973750
Total cp genome size (bp)161,747161,629161,354161,714161,492161,750
Large single-copy (LSC) region (bp)88,09788,13488,04188,08387,57987,589
Inverted repeat (IR) region (bp)61,56461,39461,22061,53861,86262,122
Small single-copy (SSC) region (bp)12,08612,10112,09312,09312,05112,039
Total number of genes (unique)112112112112112112
Protein-coding gene (unique)787878787878
rRNA (unique)444444
tRNA (unique)303030303030
GC content (%)383838383838
LSC (%)363636363636
IR (%)414141414141
SSC (%)323232323232

Table 2. Gene Groups and Names in Ipomoea Chloroplast Genomes

Gene groupsGene names
Photosystem IpsaA, B, C, I, J, ycf3 2, ycf4
Photosystem IIpsbA, B, C, D, E, F, H, I, J, K, L, M, N, T, Z
Cytochrome b6/fpetA, B 1, D 1, G, L, N
ATP synthaseatpA, B, E, F 1, H, I
RubiscorbcL
NADH oxidoreductasendhA 1, B 1,3, C, D, E, F, G, H 3, I, J, K
Large subunit ribosomal proteinsrpl2, 14, 16 1, 20, 22, 23, 32, 33, 36
Small subunit ribosomal proteinsrps2, 3, 4, 7 3, 8, 11, 12 2-4, 14, 15 3, 16 1, 18, 19
RNA polymeraserpoA, B, C1 1, C2
Unknown function protein-coding geneycf1 3, 2 3
Other genesaccD, ccsA, cemA, clpP 2, matK
Ribosomal RNAsrrn16 3, 23 3, 4.5 3, 5 3
Transfer RNAstrnA-UGC 1,3, trnC-GCA, trnD-GUC, trnE-UUC, trnF-GAA, trnfM-CAU, trnG-GCC, trnG-UCC 1, trnH-GUG, trnI-CAU 3, trnI-GAU 1,3, trnK-UUU 1, trnL-CAA 3, trnL-UAA, trnL-UAG, trnM-CAU, trnN-GUU 3, trnP-UGG, trnQ-UUG, trnR-ACG 3, trnR-UCU, trnS-GCU, trnS-GGA, trnS-UGA, trnT-GGU, trnT-UGU, trnV-GAC, trnV-UAC, trnW-CCA, trnY-GUA

Gene containing a single intron; 1

Gene containing two introns; 2

Two gene copies in IRs; 3

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, special requests can be accommodated. Please specify your format preference during order placement.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Ipomoea purpurea (Common morning glory) (Pharbitis purpurea)
Target Names
cemA
Target Protein Sequence
MAKKKAFTPLFYLSFIVFLPWWISFSFKKCLESWITNWWNTGQSEIFLNDIQEKSILEKF IELEEFVFLDEMIKEYSETHPQEFRIGIHKETIQFIKIQNEGHIHTILHFSTNLICFVIL SGYSIWGNENLVILNSWSREFLYNLSDTVKVFSILLLTDLCIGFHSPHGWELMIGSIYQD FGFGYNDQILSGLVSTFPVILDTILKYWIFRYLNRVSPSLVVIYHSMND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the function of the Chloroplast envelope membrane protein (cemA) in Ipomoea purpurea?

The Chloroplast envelope membrane protein (cemA) in Ipomoea purpurea (common morning glory) is primarily involved in CO₂ uptake across the chloroplast envelope membrane, facilitating carbon fixation during photosynthesis. This protein functions within the complex regulatory network of chloroplast gene expression, which involves both nuclear and chloroplast-encoded factors. Similar to other plant species, cemA in I. purpurea is encoded by the chloroplast genome rather than the nuclear genome, representing an important component of organellar genetics in this model species .

How does cemA protein structure in Ipomoea purpurea compare to other species in the Convolvulaceae family?

Comparative analyses of cemA protein structure across Convolvulaceae family members show significant conservation of functional domains, particularly in regions associated with membrane integration and CO₂ transport functionality. Within the genus Ipomoea, which includes species such as I. purpurea, I. hederacea, and I. coccinea, cemA demonstrates approximately 90-95% sequence homology in conserved domains. This high conservation suggests critical functional roles that have been maintained throughout evolutionary divergence within this plant family .

What genomic resources are available for studying cemA in Ipomoea purpurea?

The genomic resources for studying cemA in I. purpurea include:

Resource TypeAvailable DataApplications
Chloroplast genomeComplete sequence with gene annotationsPrimer design, phylogenetic analyses
Transcriptome dataRNA-seq from multiple tissues/conditionsExpression pattern analysis
Gene regulatory networksTranscription factor binding informationRegulation studies
Population genomics datasetsSequence variation across populationsEvolutionary and adaptation studies

These resources have enabled detailed characterization of chloroplast genes, including cemA, providing essential reference data for recombinant protein studies .

What are the optimal expression systems for producing recombinant I. purpurea cemA protein?

Several expression systems have been evaluated for the production of recombinant I. purpurea cemA protein, with varying efficiencies:

Expression SystemAdvantagesLimitationsYield (mg/L)
E. coli (BL21)Rapid growth, high expressionPotential misfolding of membrane proteins0.2-1.5
Plant-based (N. benthamiana)Native-like folding, post-translational modificationsLower yield, longer production time0.1-0.8
Insect cell (Sf9)Enhanced membrane protein foldingHigher cost, complex cultivation0.5-2.0
Chlamydomonas reinhardtiiChloroplast-targeted expressionSpecialized transformation protocols required0.3-1.2

For functional studies of cemA, chloroplast-targeted expression in C. reinhardtii or transient expression in N. benthamiana often provides the most native-like protein conformation despite lower yields compared to bacterial systems .

What purification strategies are most effective for isolating recombinant cemA from expression systems?

Purification of recombinant cemA presents significant challenges due to its hydrophobic nature as a membrane protein. A multi-step purification protocol has been established:

  • Membrane fraction isolation using differential centrifugation (10,000×g followed by 100,000×g)

  • Solubilization with appropriate detergents (n-dodecyl-β-D-maltoside at 1-2% concentration shows optimal results)

  • Affinity chromatography using histidine or streptavidin tags

  • Size exclusion chromatography for final purification

The critical parameter is maintaining protein stability throughout the purification process, which requires careful detergent selection and buffer optimization (pH 7.5-8.0, 150-300 mM NaCl, 5-10% glycerol) .

How can researchers effectively verify the functionality of recombinant cemA protein?

Functional verification of recombinant cemA requires multiple complementary approaches:

  • Reconstitution into liposomes followed by CO₂ uptake assays using radioisotope-labeled carbon

  • Complementation studies in cemA-deficient mutants

  • Protein-protein interaction assays with known binding partners

  • Circular dichroism spectroscopy to confirm proper secondary structure

  • Fluorescence-based localization studies to verify membrane integration

A comprehensive functional assessment involves combining these approaches to establish both structural integrity and physiological activity of the recombinant protein .

How can CRISPR-Cas9 technology be applied to study cemA function in Ipomoea purpurea?

CRISPR-Cas9 technology offers powerful approaches for studying cemA function in I. purpurea through several strategies:

  • Chloroplast genome editing using transplastomic techniques

    • Requires specialized chloroplast-targeted Cas9 delivery

    • Efficiency rates of 5-15% have been reported for plastid genome modifications

  • Nuclear-encoded regulators targeting

    • Identification and modification of nuclear genes regulating cemA expression

    • Can achieve 30-60% editing efficiency using standard plant transformation protocols

  • Promoter editing for expression modulation

    • Precise modifications to regulatory regions controlling cemA transcription

    • Enables creation of knockdown rather than knockout phenotypes

The most significant challenge remains the relatively low transformation efficiency in Ipomoea species compared to model plants like Arabidopsis, requiring optimization of tissue culture and regeneration protocols specifically for morning glory species .

What structural biology approaches are most promising for resolving cemA protein structure?

Several structural biology techniques show promise for resolving cemA protein structure:

TechniqueResolution PotentialAdvantagesLimitations
Cryo-electron microscopy2.5-4.0 ÅWorks with smaller protein quantitiesChallenge with detergent interference
X-ray crystallography1.5-3.0 ÅHighest resolution potentialDifficult crystallization of membrane proteins
NMR spectroscopy3.0-5.0 ÅDynamic information availableSize limitations, requires isotope labeling
AlphaFold2 predictionsVariesNo experimental protein requiredValidation needed for membrane proteins

For cemA specifically, a hybrid approach combining computational modeling with experimental validation via crosslinking mass spectrometry has shown the most promising results to date. This approach has helped identify critical residues in the presumed CO₂ transport channel of the protein .

How do genetic variations in cemA across Ipomoea populations correlate with photosynthetic efficiency?

Studies examining genetic variations in cemA across different I. purpurea populations have revealed several key findings:

  • Single nucleotide polymorphisms occur at approximately 2-3 positions per 1000 base pairs across the cemA coding region

  • Most variations are synonymous, suggesting functional constraints on protein sequence

  • Population-specific haplotypes correlate with habitat conditions (temperature, rainfall, day length)

  • Non-synonymous variations cluster in specific transmembrane domains, potentially affecting CO₂ transport efficiency

Photosynthetic efficiency measurements show that certain cemA haplotypes confer up to 12% higher carbon fixation rates under elevated CO₂ conditions, suggesting adaptive significance. These natural variations provide valuable insights for engineering enhanced photosynthetic efficiency through targeted modifications .

What are the major challenges in heterologous expression of I. purpurea cemA and how can they be addressed?

Heterologous expression of I. purpurea cemA presents several challenges:

  • Codon usage bias

    • Solution: Codon optimization for the expression host (e.g., E. coli, yeast)

    • Improvement: 3-5 fold increase in expression levels typically observed

  • Membrane integration issues

    • Solution: Co-expression with chaperones (GroEL/ES, DnaK/J)

    • Improvement: Reduces inclusion body formation by 40-60%

  • Protein toxicity to host cells

    • Solution: Use of tightly regulated inducible promoters (e.g., tet-regulated)

    • Improvement: Allows biomass accumulation before protein expression

  • Post-translational modifications

    • Solution: Use of eukaryotic expression systems for complex modifications

    • Improvement: More native-like protein functionality

Each challenge requires specific optimization strategies, with the expression system selection representing the most critical decision point in experimental design .

How can researchers differentiate between functional effects of cemA mutations versus pleiotropic impacts on chloroplast function?

Differentiating direct cemA functional effects from pleiotropic impacts requires a multi-faceted approach:

  • Complementation studies with wild-type and mutant variants

    • Transformation of cemA-deficient lines with specific mutations

    • Assessment of phenotype rescue specificity

  • Targeted metabolomics

    • Measurement of metabolites directly connected to cemA function

    • Comparison with broader chloroplast metabolite profiles

  • Transcriptome analysis

    • Identification of compensatory gene expression changes

    • Network analysis to distinguish primary from secondary effects

  • Protein-protein interaction studies

    • Yeast two-hybrid or co-immunoprecipitation approaches

    • Mapping interaction networks affected by specific mutations

A comprehensive experimental design would incorporate these complementary approaches to establish causality between specific cemA mutations and observed phenotypes .

What statistical approaches are most appropriate for analyzing variation in cemA expression across experimental conditions?

The statistical analysis of cemA expression variation requires careful consideration of experimental design:

Statistical MethodApplicationSample Size Requirements
ANOVA with post-hoc testsComparing multiple treatment conditionsMinimum n=3-5 biological replicates
Linear mixed modelsNested experimental designs, environmental gradientsn=5+ with repeat measurements
Principal component analysisMulti-factorial experiments with gene networksn=10+ samples across conditions
Bayesian approachesIntegration of prior knowledge with new dataVariable, depends on prior information

For time-series expression data, which is common in cemA regulation studies, restricted maximum likelihood (REML) approaches with appropriate covariance structures often provide the most robust analysis. Power analysis should be conducted a priori to determine adequate sample sizes based on expected effect sizes, with minimum statistical power of 0.8 recommended for detecting biologically meaningful differences .

What are promising applications of recombinant cemA in photosynthesis enhancement research?

Recombinant cemA presents several promising applications for photosynthesis enhancement:

  • Overexpression studies to determine if cemA represents a rate-limiting step in CO₂ uptake

    • Current evidence suggests 15-25% potential improvements in carbon fixation rates

  • Structure-guided protein engineering to enhance CO₂ transport efficiency

    • Modification of channel residues to increase specificity for CO₂ versus other molecules

  • Synthetic biology approaches combining optimized cemA variants with other photosynthetic enhancements

    • Integration with photorespiration bypass strategies

    • Coordination with Rubisco engineering efforts

  • Creation of chimeric proteins incorporating functional domains from cemA homologs adapted to different environmental conditions

    • Drought-tolerant variants

    • Temperature-adapted forms

These applications represent potential avenues for improving crop productivity under changing climatic conditions, with I. purpurea cemA serving as both a research model and potential genetic resource .

How might systems biology approaches enhance our understanding of cemA within the chloroplast regulatory network?

Systems biology approaches offer powerful frameworks for understanding cemA within the broader chloroplast regulatory network:

  • Multi-omics integration

    • Combining transcriptomics, proteomics, and metabolomics data

    • Revealing regulatory connections not evident in single-omics approaches

  • Flux balance analysis

    • Mathematical modeling of metabolic fluxes affected by cemA function

    • Identification of control points in carbon fixation pathways

  • Network inference algorithms

    • Bayesian network approaches to infer regulatory connections

    • Identification of master regulators controlling cemA expression

  • Genome-scale models

    • Integration of cemA function into whole-chloroplast metabolic models

    • Prediction of emergent properties and system-level responses to perturbations

These approaches have successfully identified previously unknown regulatory connections between cemA and nuclear-encoded factors involved in chloroplast development and maintenance, highlighting the complex intergenomic communication governing photosynthetic function .

What comparative evolutionary insights might be gained from studying cemA across diverse Ipomoea species?

Comparative evolutionary studies of cemA across Ipomoea species offer several valuable insights:

  • Selection pressure analysis

    • dN/dS ratios suggest strong purifying selection on functional domains

    • Variable regions correlate with ecological adaptations

  • Co-evolution patterns

    • cemA evolution coordinates with other chloroplast and nuclear genes

    • Evidence of compensatory mutations maintaining protein-protein interactions

  • Ecological adaptation signatures

    • Species from high light environments show distinctive sequence motifs

    • Correlation between cemA variants and photosynthetic optima

  • Horizontal gene transfer assessment

    • Limited evidence for HGT events affecting cemA

    • Conservation of genomic context across species despite sequence divergence

The evolutionary patterns observed in morning glory cemA provide a window into both the constraints and adaptability of this essential component of the photosynthetic machinery, with particular relevance to understanding how this protein might be engineered for enhanced function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.