Recombinant Ipomoea purpurea NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Ipomoea purpurea (Common morning glory) (Pharbitis purpurea)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDLFWAFLIISSLIPILAFFISGVLAPISKGPEKLSTYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEAFIFVLILIGGLVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) functions as an electron shuttle, transferring electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is considered the enzyme's primary electron acceptor. The process couples the redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the basic function of NAD(P)H-quinone oxidoreductase in Ipomoea purpurea?

NAD(P)H-quinone oxidoreductase in Ipomoea purpurea functions primarily as a catalyst for the two-electron reduction of quinones and a wide variety of other organic compounds. This enzyme is part of the oxidative stress defense system that converts quinones to hydroquinones, thereby avoiding the production of reactive semiquinones and reducing free radical load within the cells . In chloroplasts, the subunit 3 specifically participates in the electron transport chain as part of the NADH dehydrogenase complex, contributing to energy conversion processes during photosynthesis . Unlike many other oxidoreductases, a distinctive feature of this enzyme is its ability to work with almost equal efficiency using either NADH or NADPH as electron donors .

How does the structure of NAD(P)H-quinone oxidoreductase relate to its function?

NAD(P)H-quinone oxidoreductase functions as a homodimer with two active sites formed from residues contributed by both polypeptide chains . This quaternary structure is essential for its catalytic activity. The enzyme contains tightly bound FAD cofactors, which are reduced by NAD(P)H in the first stage of a substituted enzyme (ping-pong) mechanism . This structural organization enables the enzyme to efficiently transfer electrons from NAD(P)H to various acceptors like quinones. Research has demonstrated that the subunits may function independently with two-electron acceptors but dependently with four-electron acceptors, indicating a complex structural-functional relationship that affects substrate specificity . Mutations at specific residues, such as His-194 to Ala, can dramatically increase the Km for NADPH, demonstrating the importance of specific amino acids in cofactor binding and catalytic efficiency .

What expression systems are most effective for producing recombinant Ipomoea purpurea NAD(P)H-quinone oxidoreductase subunit 3?

Expression SystemAdvantagesLimitationsOptimal Conditions
E. coliHigh yield, rapid growth, cost-effective, well-established protocolsPotential improper folding, lack of post-translational modificationsTemperature: 16-25°C, IPTG concentration: 0.1-0.5 mM
YeastEukaryotic post-translational modifications, proper protein foldingLonger expression time, lower yields than E. coliTemperature: 28-30°C, induction with galactose or methanol
BaculovirusComplex eukaryotic modifications, high expression of functional proteinTime-consuming, technically demandingTemperature: 27°C, optimal MOI: 2-10
Mammalian CellMost authentic post-translational modificationsHighest cost, lowest yield, complex maintenanceTemperature: 37°C, 5% CO₂, serum-supplemented media

The selection of an expression system depends on the specific research requirements. For basic structural studies where post-translational modifications are less critical, E. coli remains the preferred host due to its high yield and simplicity . When studying the enzyme's interactions with other chloroplastic proteins or investigating its native activity, insect or plant expression systems may provide more relevant results. Expression in E. coli has been successful for heterodimer studies of related NAD(P)H-quinone oxidoreductases, as demonstrated in previous research where wild-type/mutant heterodimers were effectively produced for functional analysis . Regardless of the expression system chosen, optimizing codon usage for the host organism and incorporating purification tags (such as polyhistidine) significantly enhances purification efficiency .

What is the most efficient purification protocol for recombinant Ipomoea purpurea NAD(P)H-quinone oxidoreductase subunit 3?

The most efficient purification protocol for this enzyme involves a combination of affinity chromatography and size exclusion techniques. Based on established methodologies for similar enzymes, the following protocol is recommended:

  • Express the recombinant protein with a polyhistidine tag for facilitated purification.

  • Lyse cells under non-denaturing conditions using buffer containing 50 mM Tris-HCl (pH 7.5), 300 mM NaCl, 10% glycerol, 1 mM PMSF, and appropriate protease inhibitors.

  • Perform initial purification using nickel nitrilotriacetate (Ni-NTA) column chromatography with stepwise elution using increasing imidazole concentrations (20-250 mM) .

  • For higher purity, especially when separating heterodimers from homodimers, employ careful stepwise elution with imidazole under non-denaturing conditions .

  • Further purify using size exclusion chromatography to remove aggregates and obtain homogeneous protein.

  • Confirm purity using SDS-PAGE and non-denaturing PAGE followed by enzyme activity assays.

This approach has been successfully applied to related NAD(P)H:quinone oxidoreductases and yields protein preparations with >90% purity suitable for functional and structural studies . The purified enzyme should be stored in buffer containing glycerol at -20°C or -80°C for extended stability .

How can the enzymatic activity of NAD(P)H-quinone oxidoreductase be measured in research settings?

The enzymatic activity of NAD(P)H-quinone oxidoreductase can be reliably measured through several complementary approaches:

  • NADH Oxidation Assay: This is the primary method for measuring oxidoreductase activity. The assay monitors the decrease in absorbance at 340 nm corresponding to the oxidation of NADH to NAD+ in the presence of an electron acceptor such as menadione . The reaction mixture typically contains:

    • 50-100 mM potassium phosphate buffer (pH 7.4)

    • 0.1-0.2 mM NADH or NADPH

    • 0.01-0.1 mM quinone substrate (menadione is commonly used)

    • Purified enzyme or cell extract

  • Two-Electron Acceptor Assay: For kinetic analyses, various two-electron acceptors can be used, including 2,6-dichloroindophenol and menadione. This allows determination of Km and kcat values for both NADPH and NADH .

  • Four-Electron Acceptor Assay: Using substrates like methyl red enables the investigation of cooperative behavior between enzyme subunits, as previous studies have shown that subunits may function dependently with four-electron acceptors .

  • Whole Cell Extract Assay: For studying the enzyme in its natural context or when investigating post-translational modifications, whole cell lysates can be prepared by mechanical lysis and used directly in activity assays .

The choice of assay depends on the specific research question. For detailed kinetic analyses, purified enzyme with defined substrates offers the most precise data. For studies on physiological roles or post-translational regulation, the whole cell extract approach may provide more relevant insights .

What techniques can be used to study the structural characteristics of Ipomoea purpurea NAD(P)H-quinone oxidoreductase?

TechniqueInformation ObtainedSample RequirementsResolution
X-ray CrystallographyHigh-resolution 3D structure, active site architectureHighly purified, crystallizable protein (>98% purity), 5-10 mg/ml1.5-3.0 Å
Cryo-Electron Microscopy3D structure, conformational states, protein complexesPurified protein (>90% purity), 1-3 mg/ml2.5-4.0 Å
Circular DichroismSecondary structure content, thermal stabilityPurified protein (>85% purity), 0.1-0.5 mg/mlLow (secondary structure elements only)
Size Exclusion ChromatographyOligomeric state, molecular weight, complex formationPurified protein (>80% purity), 1-5 mg/mlLow (separation based on hydrodynamic radius)
Hydrogen-Deuterium Exchange MSConformational dynamics, solvent accessibilityPurified protein (>90% purity), 0.5-1 mg/mlMedium (peptide-level information)
Native Mass SpectrometryIntact complex mass, stoichiometry, subunit interactionsPurified protein (>95% purity), 1-5 μMHigh (mass accuracy <0.01%)

For studying the homodimeric structure of NAD(P)H-quinone oxidoreductase, a combination of these techniques provides complementary information. X-ray crystallography and cryo-EM are especially valuable for resolving the active site architecture and understanding how residues from both polypeptide chains contribute to the active sites . For investigating the proposed negative cooperativity in quinone oxidoreductases, hydrogen-deuterium exchange combined with kinetic studies can reveal changes in protein dynamics associated with substrate binding . Native mass spectrometry can confirm the dimeric state and detect any heterogeneity in cofactor binding.

How does the function of chloroplastic NAD(P)H-quinone oxidoreductase from Ipomoea purpurea compare to similar enzymes in other species?

The chloroplastic NAD(P)H-quinone oxidoreductase subunit 3 from Ipomoea purpurea shares fundamental mechanistic features with similar enzymes across species, but also displays species-specific adaptations:

  • Conservation Level: The ndhC gene and its protein product show high conservation across flowering plants, reflecting its essential role in photosynthetic electron transport.

  • Substrate Specificity: While the basic catalytic mechanism remains consistent, subtle variations in active site architecture can influence substrate preferences. In Ipomoea species, which produce specialized secondary metabolites including anthocyanin pigments, the enzyme may have evolved to accommodate species-specific quinone derivatives .

  • Response to Oxidative Stress: In Ipomoea purpurea, which exhibits dark purple flowers containing cyanidin-based anthocyanin pigments , the enzyme may have adapted to handle the specific oxidative challenges associated with high anthocyanin production.

  • Regulatory Mechanisms: Unlike bacterial flavodoxin-like proteins (Fld-LPs) that are often regulated through proteolytic cleavage , plant chloroplastic NAD(P)H-quinone oxidoreductases appear to be primarily regulated through transcriptional control and protein-protein interactions.

  • Evolutionary Adaptations: The enzyme in Ipomoea purpurea likely represents adaptations to the specific environmental niches and metabolic requirements of this flowering plant species, particularly in relation to its pigment biochemistry and stress response mechanisms .

These comparative insights suggest that while the fundamental catalytic mechanism is conserved, species-specific adaptations in regulatory mechanisms and substrate specificity have evolved to meet the particular physiological demands of each organism.

What role does NAD(P)H-quinone oxidoreductase play in oxidative stress response in plants?

NAD(P)H-quinone oxidoreductase serves as a crucial component of the plant's oxidative stress defense system through several mechanisms:

  • Quinone Detoxification: The enzyme catalyzes the two-electron reduction of quinones to hydroquinones, thereby preventing the formation of reactive semiquinones that would otherwise generate reactive oxygen species (ROS) . This direct detoxification function is particularly important in photosynthetic tissues where quinones are abundant.

  • Prevention of Redox Cycling: By converting quinones to stable hydroquinones through a two-electron reduction mechanism, the enzyme prevents redox cycling that would lead to superoxide generation and oxidative damage . This mechanism is especially important in plants like Ipomoea purpurea that produce specialized secondary metabolites.

  • NAD(P)H Homeostasis: Through its ability to utilize both NADH and NADPH with similar efficiency , the enzyme contributes to maintaining cellular redox balance under stress conditions. This flexibility in cofactor usage provides metabolic resilience during oxidative challenges.

  • Indirect Protection of Cellular Regulators: Similar to its mammalian counterparts, plant NAD(P)H-quinone oxidoreductases may have non-enzymatic functions in stabilizing cellular regulatory proteins , thereby contributing to stress signaling and adaptation mechanisms.

  • Integration with Photosynthetic Electron Transport: In chloroplasts, the enzyme may help redistribute electron flow under high light conditions, minimizing the production of ROS at photosystem reaction centers.

In Ipomoea purpurea specifically, the enzyme likely plays an important role in protecting against oxidative stress associated with the plant's high production of anthocyanin pigments, which are known to generate potential oxidative intermediates during their biosynthesis .

How can researchers investigate the role of NAD(P)H-quinone oxidoreductase in plant development and stress responses?

Researchers can employ multiple complementary approaches to investigate the role of NAD(P)H-quinone oxidoreductase in plant development and stress responses:

  • Gene Knockout/Knockdown Studies:

    • CRISPR-Cas9 targeted mutation of the ndhC gene in Ipomoea purpurea

    • RNAi-mediated knockdown to achieve partial suppression

    • Analysis of resulting phenotypes under normal and stress conditions (drought, high light, temperature extremes)

  • Overexpression Studies:

    • Generation of transgenic plants overexpressing native or tagged versions of the enzyme

    • Analysis of stress tolerance and developmental parameters

    • Comparison of metabolite profiles between wild-type and overexpression lines

  • Tissue-Specific and Developmental Expression Analysis:

    • RT-qPCR and in situ hybridization to map expression patterns across tissues and developmental stages

    • Promoter-reporter fusion constructs to visualize expression dynamics

    • Correlation of expression patterns with specific developmental events and stress responses

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation coupled with mass spectrometry to identify interaction partners

    • Bimolecular fluorescence complementation (BiFC) to visualize interactions in planta

    • Yeast two-hybrid screening to identify potential regulatory proteins

  • Metabolomic Approaches:

    • Targeted and untargeted metabolite profiling to identify changes in quinone/hydroquinone levels

    • Analysis of redox-related metabolites (glutathione, ascorbate) in wild-type vs. mutant plants

    • Isotope labeling to track electron flow through different metabolic pathways

  • Comparative Analyses Among Ipomoea Species:

    • Leveraging the diversity in flower pigmentation among Ipomoea species (I. nil with bright blue flowers, I. purpurea with dark purple flowers, and various mutants with reddish flowers ) to correlate enzyme variants with specific physiological adaptations

This multi-faceted approach allows researchers to establish both the developmental significance and stress-responsive functions of NAD(P)H-quinone oxidoreductase in Ipomoea purpurea, potentially revealing novel roles beyond its characterized enzymatic activity.

How can heterologous expression systems be optimized for studying mutant variants of Ipomoea purpurea NAD(P)H-quinone oxidoreductase?

Optimizing heterologous expression of mutant variants requires strategic approaches addressing multiple parameters:

  • Codon Optimization Strategy:

    • Analyze codon usage bias between Ipomoea purpurea and expression host

    • Generate synthetic genes with optimized codons while maintaining key regulatory elements

    • For studying multiple mutants, design a modular cloning system allowing easy substitution of mutated regions

  • Expression Vector Selection:

    • For basic kinetic studies: pET series vectors in E. coli with T7 promoter control

    • For structural studies: vectors incorporating fusion tags that enhance solubility (SUMO, MBP) while maintaining enzymatic function

    • For in vivo interaction studies: vectors compatible with plant transformation systems

  • Mutation Design Strategy:

    • Structure-guided mutations based on homology models if crystal structure is unavailable

    • Site-directed mutagenesis of residues predicted to interact with substrates or cofactors

    • Introduction of known mutations from related enzymes, such as the His-194→Ala mutation previously studied in related NAD(P)H:quinone oxidoreductases that increases Km for NADPH

  • Co-expression of Chaperones:

    • Include molecular chaperones (GroEL/ES, DnaK/J) to enhance proper folding

    • Co-express with potential interacting partners if studying protein complexes

    • For difficult-to-express mutants, consider low-temperature induction protocols (16-18°C)

  • Purification Strategy for Heterodimers:

    • For studying subunit interactions, express wild-type and mutant subunits with different affinity tags (polyhistidine tag on one subunit) to enable purification of heterodimers through stepwise elution with imidazole from nickel nitrilotriacetate columns under non-denaturing conditions

    • Confirm heterodimer composition using both SDS and non-denaturing polyacrylamide gel electrophoresis combined with immunoblot analysis

  • Functional Validation Protocol:

    • Develop a systematic workflow to compare wild-type and mutant enzymes using both two-electron acceptors (2,6-dichloroindophenol, menadione) and four-electron acceptors (methyl red)

    • Establish kinetic parameters (Km, kcat) for both NADPH and NADH to evaluate cofactor preference shifts in mutants

This comprehensive approach has proven successful for related enzymes, where researchers were able to express and purify wild-type/mutant heterodimers and demonstrate that subunits function independently with two-electron acceptors but dependently with four-electron acceptors .

What are the methodological approaches for investigating the electron transfer mechanism in NAD(P)H-quinone oxidoreductase?

Investigating the electron transfer mechanism in NAD(P)H-quinone oxidoreductase requires sophisticated methodological approaches that span multiple time and spatial scales:

  • Transient Kinetic Measurements:

    • Stop-flow spectroscopy to monitor rapid changes in FAD redox state during catalysis

    • Rapid chemical quench methods to trap reaction intermediates

    • Pre-steady-state kinetics to resolve individual steps in the substituted enzyme (ping-pong) mechanism

  • Spectroscopic Characterization:

    • Electron paramagnetic resonance (EPR) to detect and characterize radical intermediates

    • Resonance Raman spectroscopy to probe structural changes during electron transfer

    • Fluorescence spectroscopy to monitor FAD environment changes during catalysis

  • Targeted Mutagenesis Approach:

    • Systematic mutation of residues in the electron transfer pathway

    • Creation of heterodimers with one subunit containing active site mutations to study inter-subunit electron transfer

    • Analysis of Km and kcat values with different electron acceptors to identify rate-limiting steps

  • Computational Methods:

    • Molecular dynamics simulations to model conformational changes during electron transfer

    • Quantum mechanical/molecular mechanical (QM/MM) calculations to model the energetics of electron transfer

    • Docking studies with various quinone substrates to establish structure-activity relationships

  • Isotope Effect Studies:

    • Deuterium kinetic isotope effect measurements to identify rate-limiting hydrogen transfer steps

    • 15N and 13C labeling to trace electron movements using NMR spectroscopy

  • Electrochemical Approaches:

    • Protein film voltammetry to directly measure electron transfer rates

    • Determination of reduction potentials for enzyme-bound FAD and various quinone substrates

These methodological approaches can be applied to understand the unique aspects of electron transfer in Ipomoea purpurea NAD(P)H-quinone oxidoreductase, particularly how the enzyme achieves similar efficiency with both NADH and NADPH cofactors and how electron transfer might differ between two-electron acceptors (where subunits function independently) and four-electron acceptors (where subunits function dependently) .

How can researchers investigate the potential role of NAD(P)H-quinone oxidoreductase in flower pigmentation in Ipomoea purpurea?

Investigating the relationship between NAD(P)H-quinone oxidoreductase and flower pigmentation in Ipomoea purpurea requires an integrated approach that connects enzyme function with pigment biosynthesis:

  • Comparative Expression Analysis:

    • Quantify enzyme expression across Ipomoea species with different flower colors (I. nil with bright blue flowers, I. purpurea with dark purple flowers, and mutants with reddish flowers)

    • Perform stage-specific transcriptome analysis during flower development

    • Compare expression patterns between wild-type and color mutants, particularly those carrying the pink allele in I. purpurea

  • In situ Localization Studies:

    • Immunohistochemistry using antibodies against NAD(P)H-quinone oxidoreductase

    • RNA in situ hybridization to visualize transcript distribution in developing flowers

    • Create reporter gene fusions to visualize enzyme expression patterns in different floral tissues

  • Metabolic Profiling Approach:

    • Targeted analysis of anthocyanin intermediates in wild-type and enzyme-modified plants

    • Measurement of redox status in pigment-producing cells using redox-sensitive fluorescent proteins

    • Quantification of cyanidin-based anthocyanin pigments versus pelargonidin derivatives in relationship to enzyme activity

  • Genetic Modification Strategy:

    • Generate transgenic plants with altered NAD(P)H-quinone oxidoreductase expression

    • Analyze changes in flower color and pigment profiles

    • Introduce the enzyme into known color mutants to assess rescue of wild-type pigmentation

  • Enzyme-Substrate Interaction Studies:

    • In vitro enzyme assays using pigment pathway intermediates as substrates

    • Identification of specific quinones in the anthocyanin pathway that might be enzyme substrates

    • Testing whether the enzyme can reduce intermediates in the flavonoid 3'-hydroxylase (F3'H) pathway, which is known to influence flower color in Ipomoea species

  • Co-expression Network Analysis:

    • Construct gene co-expression networks from transcriptome data

    • Identify correlations between enzyme expression and known pigmentation genes

    • Focus especially on relationships with the F3'H gene, which when deficient leads to reddish flowers containing pelargonidin derivatives instead of cyanidin-based anthocyanins

This multifaceted approach could reveal whether NAD(P)H-quinone oxidoreductase plays a direct role in flower pigmentation by facilitating specific redox reactions in the anthocyanin biosynthetic pathway, or an indirect role by maintaining cellular redox homeostasis during the high metabolic activity associated with pigment production.

How should researchers interpret discrepancies in kinetic data when studying NAD(P)H-quinone oxidoreductase from different expression systems?

When confronted with kinetic data discrepancies across expression systems, researchers should implement a systematic analytical framework:

  • Systematic Variance Analysis:

    • Categorize discrepancies by parameter type (Km, kcat, substrate specificity)

    • Determine if differences follow consistent patterns across multiple experiments

    • Compare relative rather than absolute values when possible to minimize system-specific biases

  • Post-translational Modification Assessment:

    • Analyze protein samples from different expression systems using mass spectrometry to identify modifications

    • Compare modification profiles with kinetic parameters to identify correlations

    • Test the effect of specific modifications by expressing the enzyme in systems with different post-translational processing capabilities

  • Protein Folding and Structural Integrity Evaluation:

    • Perform circular dichroism and thermal shift assays to compare structural integrity

    • Use limited proteolysis to assess conformational differences

    • Examine FAD binding stoichiometry and affinity across different preparations

  • Heterogeneity Assessment:

    • Apply size exclusion chromatography and analytical ultracentrifugation to determine oligomeric state distribution

    • Use native mass spectrometry to identify potential contaminants or truncated forms

    • Evaluate the impact of heterodimer formation in samples containing mixed enzyme species

  • Experimental Condition Standardization:

    • Develop a uniform buffer system that works across all enzyme preparations

    • Standardize protein concentration determination methods

    • Control for trace metal contamination that might affect catalytic activity

  • Statistical Approach to Reconciliation:

    • Apply mixed-effects models to account for systematic variations between expression systems

    • Develop correction factors based on activity with standard substrates

    • Consider Bayesian approaches to integrate data from different sources with appropriate uncertainty quantification

By applying this systematic approach, researchers can determine whether discrepancies reflect genuine functional differences due to post-translational modifications or structural variations, or are artifacts of the expression and purification process. This is particularly important for NAD(P)H-quinone oxidoreductase, where subunit interactions can significantly influence kinetic parameters, especially with four-electron acceptors .

What statistical approaches are most appropriate for analyzing structure-function relationships in NAD(P)H-quinone oxidoreductase variants?

When analyzing structure-function relationships in NAD(P)H-quinone oxidoreductase variants, researchers should employ statistical approaches that account for the complex, multidimensional nature of the data:

  • Multivariate Statistical Techniques:

    • Principal Component Analysis (PCA) to identify patterns in kinetic parameters across multiple variants

    • Partial Least Squares (PLS) regression to correlate structural features with functional outcomes

    • Hierarchical clustering to group variants based on functional similarity

  • Non-linear Regression Models for Enzyme Kinetics:

    • Apply model discrimination techniques to determine whether variants follow the same kinetic mechanism

    • Use global fitting approaches when analyzing data from multiple substrates simultaneously

    • Incorporate substrate inhibition and cooperativity parameters when appropriate

  • Statistical Coupling Analysis (SCA):

    • Identify co-evolving residues in sequence alignments across species

    • Correlate conservation patterns with functional domains

    • Build connectivity networks to visualize functional residue clusters

  • Machine Learning Approaches:

    • Support Vector Machines (SVM) to classify variants based on multiple parameters

    • Random Forest algorithms to rank the importance of structural features in determining function

    • Neural networks to predict functional outcomes from sequence or structural data

  • Bayesian Statistical Framework:

    • Develop Bayesian models that incorporate prior knowledge about enzyme mechanisms

    • Use Markov Chain Monte Carlo (MCMC) methods to sample the posterior distribution of kinetic parameters

    • Calculate Bayes factors to compare competing models of enzyme function

  • Structure-Based Statistical Methods:

    • Distance-based statistical methods to correlate residue positions with functional changes

    • Graph-theoretical approaches to analyze changes in interaction networks

    • Energy-based statistical potentials to evaluate stability changes in variants

These statistical approaches are particularly valuable when analyzing the complex behavior observed in NAD(P)H-quinone oxidoreductase, such as the independent functioning of subunits with two-electron acceptors versus dependent functioning with four-electron acceptors . By applying these methods to data from wild-type, mutant, and heterodimer forms of the enzyme, researchers can develop comprehensive models that explain how specific structural features contribute to the enzyme's catalytic versatility and substrate specificity.

How can researchers reconcile in vitro enzymatic data with in vivo functional studies of NAD(P)H-quinone oxidoreductase?

Reconciling in vitro enzymatic data with in vivo functional studies requires methodological approaches that bridge the gap between controlled laboratory conditions and complex biological systems:

  • Physiologically Relevant Assay Design:

    • Develop in vitro assays that mimic cellular conditions (pH, ion concentrations, crowding agents)

    • Incorporate potential interacting proteins identified in vivo

    • Test activity with natural substrate mixtures rather than individual compounds

  • Correlation Analysis Framework:

    • Establish quantitative relationships between in vitro parameters (Km, kcat) and in vivo phenotypes

    • Use regression models to identify which in vitro parameters best predict in vivo outcomes

    • Develop scaling factors to translate between in vitro and in vivo measurements

  • Whole Cell Extract Studies:

    • Measure oxidoreductase activity in whole cell lysates to capture the native regulatory environment

    • Compare results from purified enzyme with those from cell extracts under identical conditions

    • Identify factors in cell extracts that modify enzyme activity

  • In Situ Activity Visualization:

    • Develop fluorescent or luminescent probes that report enzyme activity in living cells

    • Use microscopy to map activity patterns across different tissues and developmental stages

    • Correlate spatial activity patterns with phenotypic observations

  • Integrated Mathematical Modeling:

    • Develop kinetic models incorporating data from both in vitro and in vivo studies

    • Use systems biology approaches to place the enzyme in its metabolic context

    • Perform sensitivity analysis to identify parameters with the greatest impact on system behavior

  • Genetic Complementation Strategy:

    • Express enzyme variants with defined in vitro properties in knockout/knockdown backgrounds

    • Quantify the degree of phenotypic rescue as a function of enzymatic parameters

    • Use site-directed mutagenesis to create variants with specific alterations to kinetic properties

This integrated approach is particularly important for NAD(P)H-quinone oxidoreductase, which has both enzymatic and non-enzymatic functions . By methodically connecting in vitro measurements with in vivo observations, researchers can develop a more complete understanding of how the enzyme's biochemical properties translate into biological functions in Ipomoea purpurea, particularly in contexts such as oxidative stress response and potential roles in flower pigmentation pathways .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.