NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) is a critical component of the NAD(P)H dehydrogenase complex located in the chloroplast genome of Ipomoea purpurea. This protein belongs to the broader NAD(P)H:quinone oxidoreductase (NQO) gene family, which is part of the flavoprotein clan . The NQO family plays fundamental roles in plant metabolism, particularly in redox reactions and oxidative stress responses.
In Ipomoea purpurea, the chloroplast genome exhibits a quadripartite structure consisting of a large single-copy (LSC) region, a small single-copy (SSC) region, and a pair of inverted repeats (IRs) . The chloroplast genome of related Ipomoea species ranges from 159,691 bp to 161,750 bp in length, with the ndhE gene being one of the essential components encoded within this genome .
The chloroplast genome of Ipomoea species contains approximately 112-141 genes, including protein-coding genes, transfer RNAs, and ribosomal RNAs. Among these, the NADH oxidoreductase genes, including ndhE, play crucial roles in electron transport and energy metabolism .
Recent studies on Ipomoea species have revealed important insights into the organization of chloroplast genomes, including the genetic context of the ndhE gene. Table 1 presents a comparison of chloroplast genome characteristics across several Ipomoea species.
| Species | Total Genome Size (bp) | LSC Region (bp) | IR Region (bp) | SSC Region (bp) | GC Content (%) | Number of Genes |
|---|---|---|---|---|---|---|
| I. nil | 161,747 | 88,097 | 61,564 | 12,086 | 38 | 112 |
| I. purpurea | 161,629 | 88,134 | 61,394 | 12,101 | 38 | 112 |
| I. hederacea | 161,354 | 88,041 | 61,220 | 12,093 | 38 | 112 |
| I. hederacea var. integriuscula | 161,714 | 88,083 | 61,538 | 12,093 | 38 | 112 |
| I. lacunosa | 161,492 | 87,579 | 61,862 | 12,051 | 38 | 112 |
| I. triloba | 161,750 | 87,589 | 62,122 | 12,039 | 38 | 112 |
Data compiled from search result
Within this genomic context, the ndhE gene is consistently present as part of the NADH oxidoreductase gene complex, underscoring its essential role in chloroplast function across Ipomoea species.
NAD(P)H-quinone oxidoreductases play pivotal roles in plant metabolism and stress responses. These enzymes catalyze the reduction of quinones and other electron acceptors using NADPH or NADH as electron donors .
The primary function of NAD(P)H-quinone oxidoreductase is to catalyze the two-electron reduction of quinones to hydroquinones. This reaction is biochemically significant as it prevents the formation of semiquinones, which are highly reactive oxygen species that can cause cellular damage . The enzyme thus serves as a protective mechanism against oxidative stress.
NAD(P)H-quinone oxidoreductases typically exhibit distinct preferences for electron donors. Some preferentially utilize NADPH, while others primarily utilize NADH for quinone reduction. For instance, in related enzyme systems, CYP450OR has been shown to preferentially utilize NADPH for redox cycling activity, whereas NQO1 primarily utilizes NADH, highlighting the complementary nature of these systems in maintaining cellular redox homeostasis .
In plant systems, NAD(P)H-quinone oxidoreductases contribute significantly to oxidative stress responses. These enzymes help detoxify reactive quinones, which can be produced endogenously or derived from environmental sources . By efficiently reducing these compounds, they prevent the formation of harmful reactive oxygen species and protect cellular components from oxidative damage.
Studies in diverse organisms have demonstrated that NAD(P)H-quinone oxidoreductases are essential for maintaining cellular redox balance. In particular, they contribute to the regulation of the reduced-to-oxidized ratios of nicotinamide dinucleotides, which are crucial for numerous metabolic processes .
Recombinant Ipomoea purpurea NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic has been successfully produced through expression in E. coli, providing valuable material for structural and functional studies .
The recombinant protein is typically produced by expressing the ndhE gene from Ipomoea purpurea in E. coli expression systems. The protein is fused to an N-terminal His tag to facilitate purification through affinity chromatography methods . After expression, the protein is purified to greater than 90% purity as determined by SDS-PAGE analysis.
The recombinant protein exhibits several important physical and chemical properties that are relevant to its function and applications (Table 2).
| Property | Characteristic |
|---|---|
| Length | 101 amino acids |
| Amino Acid Sequence | MMLEYALVLSAFLFSIGIYGLITSRNMVRALMCLELILNAVNMNLVTFSYFFDNRQLKGDIFSIFIIAIAAAEAAIGLAIVSSIYRNRKSTRIDQSNLLNN |
| Form | Lyophilized powder |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Optimal Storage | -20°C/-80°C |
| Reconstitution | Deionized sterile water to 0.1-1.0 mg/mL with recommended 5-50% glycerol for long-term storage |
| Purity | >90% as determined by SDS-PAGE |
Data compiled from search result
The amino acid sequence suggests a predominantly hydrophobic protein with transmembrane domains, consistent with its function as part of the chloroplast membrane protein complex .
NAD(P)H-quinone oxidoreductases form part of a diverse enzyme family with members exhibiting varied substrate specificities and electron donor preferences.
Studies on related NAD(P)H-quinone oxidoreductases have revealed that these enzymes can exhibit distinct substrate specificity profiles. Some preferentially reduce benzoquinones, while others show higher activity with naphthoquinones . This diversity in substrate preference allows organisms to detoxify a wide range of quinone compounds effectively.
Regarding electron donor preference, experimental evidence from related systems indicates that NAD(P)H-quinone oxidoreductases can differ in their utilization of NADH versus NADPH. For instance, some enzymes preferentially utilize NADPH for redox cycling activity, while others primarily employ NADH . This functional diversity ensures that organisms can maintain redox homeostasis under various physiological conditions.
The conservation of NAD(P)H-quinone oxidoreductase genes across diverse plant species suggests their fundamental importance in plant metabolism and stress responses. In the Ipomoea genus, comparative genomic analyses have revealed high conservation of chloroplast genes, including those encoding components of the NAD(P)H dehydrogenase complex .
The ndhE gene, which encodes NAD(P)H-quinone oxidoreductase subunit 4L, has been consistently identified in various Ipomoea species, including I. purpurea, I. nil, I. triloba, and I. pes-caprae . This conservation underscores the essential nature of this gene in chloroplast function and plant physiology.
Recombinant NAD(P)H-quinone oxidoreductase subunit 4L from Ipomoea purpurea has several potential applications in research and biotechnology.
The availability of recombinant NAD(P)H-quinone oxidoreductase subunit 4L facilitates studies on chloroplast function and evolution. By investigating the structure and function of this protein, researchers can gain insights into the mechanisms of electron transport in chloroplasts and the evolutionary adaptations of photosynthetic organisms .
Given the role of NAD(P)H-quinone oxidoreductases in oxidative stress responses, the recombinant protein can be used to study how plants cope with environmental stressors such as pollution, herbicides, and other xenobiotics. Such studies could provide valuable information for developing strategies to enhance plant resistance to various stressors .
Research on Recombinant Ipomoea purpurea NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic opens several promising avenues for future investigation.
Studies investigating the function of NAD(P)H-quinone oxidoreductase subunit 4L in the context of the whole plant could reveal its role in various physiological processes, including photosynthesis, respiration, and responses to environmental stressors. Techniques such as gene silencing or CRISPR-Cas9-mediated gene editing could be employed to elucidate the in vivo function of this protein .
NAD(P)H-quinone oxidoreductase functions as a key enzyme involved in defense against reactive forms of oxygen, particularly in chloroplasts where oxidative stress is common. The enzyme catalyzes the two- or four-electron reduction of quinones and other organic compounds, using either NADH or NADPH as reducing cofactors and requiring FAD as a prosthetic group . In plant systems, particularly in Ipomoea purpurea (morning glory), the chloroplastic NAD(P)H-quinone oxidoreductase subunit 4L plays crucial roles in:
The enzyme typically operates via a 'ping-pong' kinetic mechanism where the reduced pyridine nucleotide binds to the active site, reduces the flavin co-factor to FADH₂, and then the substrate binds and is reduced .
While both enzymes catalyze similar reactions, they differ in several important aspects:
Understanding these differences is essential when designing experiments targeting the specific chloroplastic isoform from Ipomoea purpurea.
Successful expression and purification can be achieved through the following methodological approach:
Expression system selection: E. coli BL21(DE3) is recommended due to its high expression yield and compatibility with chloroplastic proteins. Include a chloroplast transit peptide removal during construct design as this sequence can interfere with proper folding.
Vector optimization: Incorporate a His-tag or other affinity tag to facilitate purification, preferably at the C-terminus to avoid interference with enzymatic activity.
Expression conditions: Induce at lower temperatures (16-18°C) for 16-18 hours to enhance solubility of the recombinant protein.
Purification protocol:
Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin
Ion exchange chromatography to remove contaminants
Size exclusion chromatography to ensure homogeneity
Activity preservation: Include FAD (5-10 μM) in all purification buffers to maintain enzymatic activity, as the cofactor can be lost during purification steps .
Storage conditions: Store with 10% glycerol at -80°C to preserve activity for extended periods.
Several complementary approaches can be used to accurately measure enzyme activity:
Spectrophotometric assays:
Inhibitor-based confirmation:
In-gel activity stain:
Separate proteins by native PAGE
Incubate gel with NADH/NADPH and nitroblue tetrazolium (NBT)
Active enzyme will produce a blue-purple formazan precipitate
When working with plant extracts specifically from Ipomoea purpurea, include steps to remove phenolic compounds that can interfere with the assays by adding polyvinylpolypyrrolidone (PVPP) during extraction.
Based on established methodologies, the following protocols can be implemented:
Dihydroethidium (DHE) oxidation assay:
Pyrogallol auto-oxidation:
Electron spin resonance (ESR) spectroscopy:
Cellular models:
These methodologies should be adapted for plant-specific contexts when working with the Ipomoea purpurea chloroplastic isoform.
Several critical factors must be addressed:
Redox environment control:
Maintain reducing conditions during purification and assays (add DTT or β-mercaptoethanol)
Consider the impact of oxygen concentration on experimental outcomes
Include controls for spontaneous oxidation of substrates
Substrate selection:
Experimental models:
Analytical approaches:
Employ HPLC to quantify reduction products
Use LC-MS/MS for comprehensive metabolite profiling
Consider proteomic analysis to identify interaction partners
Controls and validations:
Include enzymatically inactive mutants as negative controls
Validate findings across multiple experimental systems
Use specific inhibitors to confirm enzyme specificity
A comprehensive investigation requires multiple complementary approaches:
Gene expression analysis:
Quantify gene expression under various stress conditions (drought, high light, heat, pathogen attack)
Use qRT-PCR to measure transcript levels
Perform RNA-seq to identify co-regulated gene networks
Protein level assessment:
Develop specific antibodies against the Ipomoea purpurea isoform
Use western blotting to quantify protein levels under stress
Employ immunolocalization to determine subcellular redistribution
Functional studies:
Generate transgenic plants with altered expression levels
Assess stress tolerance phenotypes (ROS accumulation, lipid peroxidation, photosynthetic efficiency)
Perform metabolomics to identify changes in quinone and antioxidant profiles
In vivo activity measurement:
Develop methods to measure enzyme activity in intact chloroplasts
Use non-invasive fluorescence techniques when possible
Correlate activity with physiological responses
The activity of chloroplastic NAD(P)H-quinone oxidoreductase is especially relevant in high light stress conditions, when the risk of oxidative damage is greatest. Design experiments with appropriate light intensity controls and acclimation periods.
Several advanced techniques can reveal interaction networks:
Particular attention should be paid to interactions with ascorbate-glutathione cycle enzymes and thioredoxin-dependent systems, which are known to coordinate with NAD(P)H-dependent reductases in chloroplasts.
Building on findings with other NQO1 enzymes, the following methodologies are recommended:
Cytotoxicity screening:
Mechanism of action studies:
Cell cycle analysis:
Molecular pathway investigations:
This approach leverages the known anticancer properties of Ipomoea purpurea extracts while focusing specifically on the contribution of NAD(P)H-quinone oxidoreductase mechanisms.
Researchers frequently encounter several issues that can be systematically addressed:
Insoluble protein expression:
Lower induction temperature to 16-18°C
Use solubility-enhancing fusion tags (SUMO, MBP, TRX)
Consider cell-free expression systems for difficult constructs
Optimize codon usage for E. coli expression
Loss of FAD cofactor:
Supplement expression media with riboflavin
Add FAD to all purification buffers (5-10 μM)
Monitor the characteristic yellow color as an indicator of FAD retention
Measure A280/A450 ratio to assess FAD content
Protein instability:
Include protease inhibitors throughout purification
Add reducing agents to prevent oxidation-induced aggregation
Optimize buffer conditions (pH 7.0-7.5, 150-300 mM NaCl)
Consider addition of glycerol (10-20%) to stabilize the enzyme
Low activity recovery:
Test activity immediately after each purification step
Develop a rapid purification protocol to minimize time
Ensure anaerobic conditions when possible to prevent oxidative damage
Determine optimal storage conditions (typically -80°C with 10-20% glycerol)
Differentiation between isoforms requires targeted methodologies:
Antibody development:
Generate isoform-specific antibodies targeting unique epitopes
Validate antibody specificity using recombinant proteins and knockout lines
Use these for western blotting, immunoprecipitation, and immunolocalization
Activity-based discrimination:
Develop inhibitor profiles specific to each isoform
Use subcellular fractionation to separate chloroplastic and cytosolic enzymes
Employ different substrate preferences to distinguish activities
Genetic approaches:
Design isoform-specific primers for qRT-PCR analysis
Create reporter constructs with isoform-specific promoters
Generate CRISPR/Cas9 knockouts targeting specific isoforms
Mass spectrometry-based identification:
Identify unique peptide signatures for each isoform
Use targeted proteomics (SRM/MRM) for isoform quantification
Apply proteomic approaches to isolated organelles
These approaches are particularly important when studying Ipomoea purpurea, which may contain multiple NAD(P)H-quinone oxidoreductase isoforms with overlapping functions but distinct subcellular localizations.
Conflicting results can be addressed through systematic evaluation:
Standardization of experimental conditions:
Create detailed protocols for enzyme preparation and assays
Control for variables like pH, temperature, substrate concentration, and oxygen levels
Establish positive and negative controls for each assay system
Multi-method validation:
Genetic confirmation:
Generate knockout/knockdown plants to confirm enzyme function
Create complementation lines expressing the wild-type or mutated enzyme
Perform rescue experiments with recombinant protein
Cross-species comparison:
Collaborative validation:
Establish multi-laboratory validation of key findings
Share standardized materials (recombinant proteins, antibodies, plant lines)
Develop consensus protocols for activity measurements
Several cutting-edge strategies show particular promise:
Directed evolution:
Apply error-prone PCR to generate variant libraries
Develop high-throughput screening methods based on quinone reduction
Select for enhanced stability, altered substrate specificity, or increased catalytic efficiency
Structure-guided engineering:
Use homology modeling based on related NQO structures
Identify key residues for substrate binding and catalysis
Design rational mutations to enhance desired properties
Domain swapping experiments:
Exchange domains between cytosolic and chloroplastic isoforms
Create chimeric proteins with altered localization or activity profiles
Identify minimal functional domains required for specific activities
Post-translational modification engineering:
Identify native modifications affecting enzyme function
Modify phosphorylation, acetylation, or other regulatory sites
Design variants resistant to oxidative inactivation
These approaches can lead to enzymes with enhanced stress protection capabilities for agricultural applications or improved properties for biocatalytic applications.
A comprehensive multi-omics strategy would involve:
Transcriptomics:
Perform RNA-seq under various stress conditions
Identify co-expressed gene networks
Characterize alternative splicing patterns
Proteomics:
Map the protein-protein interaction network
Identify post-translational modifications
Quantify changes in protein abundance under stress
Metabolomics:
Profile quinone and hydroquinone levels
Track changes in antioxidant metabolites
Identify novel substrates or products
Phenomics:
Correlate enzyme activity with whole-plant phenotypes
Use high-throughput phenotyping to assess stress responses
Identify subtle phenotypic changes in mutant lines
Data integration:
Develop computational models linking gene expression, protein activity, and metabolite levels
Apply machine learning to identify patterns across datasets
Create predictive models of plant stress responses
This integrative approach would place NAD(P)H-quinone oxidoreductase function within the broader context of plant metabolism and stress response networks.