Recombinant Ipomoea purpurea NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Shipped with Ice Packs
In Stock

Description

Introduction to NAD(P)H-Quinone Oxidoreductase in Ipomoea purpurea

NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) is a critical component of the NAD(P)H dehydrogenase complex located in the chloroplast genome of Ipomoea purpurea. This protein belongs to the broader NAD(P)H:quinone oxidoreductase (NQO) gene family, which is part of the flavoprotein clan . The NQO family plays fundamental roles in plant metabolism, particularly in redox reactions and oxidative stress responses.

In Ipomoea purpurea, the chloroplast genome exhibits a quadripartite structure consisting of a large single-copy (LSC) region, a small single-copy (SSC) region, and a pair of inverted repeats (IRs) . The chloroplast genome of related Ipomoea species ranges from 159,691 bp to 161,750 bp in length, with the ndhE gene being one of the essential components encoded within this genome .

Genetic Organization in Chloroplast Genome

The chloroplast genome of Ipomoea species contains approximately 112-141 genes, including protein-coding genes, transfer RNAs, and ribosomal RNAs. Among these, the NADH oxidoreductase genes, including ndhE, play crucial roles in electron transport and energy metabolism .

Comparative Analysis of Chloroplast Genome Organization

Recent studies on Ipomoea species have revealed important insights into the organization of chloroplast genomes, including the genetic context of the ndhE gene. Table 1 presents a comparison of chloroplast genome characteristics across several Ipomoea species.

Table 1: Chloroplast Genome Characteristics of Selected Ipomoea Species

SpeciesTotal Genome Size (bp)LSC Region (bp)IR Region (bp)SSC Region (bp)GC Content (%)Number of Genes
I. nil161,74788,09761,56412,08638112
I. purpurea161,62988,13461,39412,10138112
I. hederacea161,35488,04161,22012,09338112
I. hederacea var. integriuscula161,71488,08361,53812,09338112
I. lacunosa161,49287,57961,86212,05138112
I. triloba161,75087,58962,12212,03938112

Data compiled from search result

Within this genomic context, the ndhE gene is consistently present as part of the NADH oxidoreductase gene complex, underscoring its essential role in chloroplast function across Ipomoea species.

Functional Characteristics of NAD(P)H-Quinone Oxidoreductase

NAD(P)H-quinone oxidoreductases play pivotal roles in plant metabolism and stress responses. These enzymes catalyze the reduction of quinones and other electron acceptors using NADPH or NADH as electron donors .

Biochemical Function and Mechanisms

The primary function of NAD(P)H-quinone oxidoreductase is to catalyze the two-electron reduction of quinones to hydroquinones. This reaction is biochemically significant as it prevents the formation of semiquinones, which are highly reactive oxygen species that can cause cellular damage . The enzyme thus serves as a protective mechanism against oxidative stress.

NAD(P)H-quinone oxidoreductases typically exhibit distinct preferences for electron donors. Some preferentially utilize NADPH, while others primarily utilize NADH for quinone reduction. For instance, in related enzyme systems, CYP450OR has been shown to preferentially utilize NADPH for redox cycling activity, whereas NQO1 primarily utilizes NADH, highlighting the complementary nature of these systems in maintaining cellular redox homeostasis .

Role in Oxidative Stress Response

In plant systems, NAD(P)H-quinone oxidoreductases contribute significantly to oxidative stress responses. These enzymes help detoxify reactive quinones, which can be produced endogenously or derived from environmental sources . By efficiently reducing these compounds, they prevent the formation of harmful reactive oxygen species and protect cellular components from oxidative damage.

Studies in diverse organisms have demonstrated that NAD(P)H-quinone oxidoreductases are essential for maintaining cellular redox balance. In particular, they contribute to the regulation of the reduced-to-oxidized ratios of nicotinamide dinucleotides, which are crucial for numerous metabolic processes .

Recombinant Production and Characteristics

Recombinant Ipomoea purpurea NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic has been successfully produced through expression in E. coli, providing valuable material for structural and functional studies .

Production and Purification Methods

The recombinant protein is typically produced by expressing the ndhE gene from Ipomoea purpurea in E. coli expression systems. The protein is fused to an N-terminal His tag to facilitate purification through affinity chromatography methods . After expression, the protein is purified to greater than 90% purity as determined by SDS-PAGE analysis.

Physical and Chemical Properties

The recombinant protein exhibits several important physical and chemical properties that are relevant to its function and applications (Table 2).

Table 2: Physical and Chemical Properties of Recombinant Ipomoea purpurea NAD(P)H-quinone oxidoreductase subunit 4L

PropertyCharacteristic
Length101 amino acids
Amino Acid SequenceMMLEYALVLSAFLFSIGIYGLITSRNMVRALMCLELILNAVNMNLVTFSYFFDNRQLKGDIFSIFIIAIAAAEAAIGLAIVSSIYRNRKSTRIDQSNLLNN
FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Optimal Storage-20°C/-80°C
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL with recommended 5-50% glycerol for long-term storage
Purity>90% as determined by SDS-PAGE

Data compiled from search result

The amino acid sequence suggests a predominantly hydrophobic protein with transmembrane domains, consistent with its function as part of the chloroplast membrane protein complex .

Comparative Analysis with Related Enzymes

NAD(P)H-quinone oxidoreductases form part of a diverse enzyme family with members exhibiting varied substrate specificities and electron donor preferences.

Substrate Specificity and Electron Donor Preference

Studies on related NAD(P)H-quinone oxidoreductases have revealed that these enzymes can exhibit distinct substrate specificity profiles. Some preferentially reduce benzoquinones, while others show higher activity with naphthoquinones . This diversity in substrate preference allows organisms to detoxify a wide range of quinone compounds effectively.

Regarding electron donor preference, experimental evidence from related systems indicates that NAD(P)H-quinone oxidoreductases can differ in their utilization of NADH versus NADPH. For instance, some enzymes preferentially utilize NADPH for redox cycling activity, while others primarily employ NADH . This functional diversity ensures that organisms can maintain redox homeostasis under various physiological conditions.

Evolutionary Conservation

The conservation of NAD(P)H-quinone oxidoreductase genes across diverse plant species suggests their fundamental importance in plant metabolism and stress responses. In the Ipomoea genus, comparative genomic analyses have revealed high conservation of chloroplast genes, including those encoding components of the NAD(P)H dehydrogenase complex .

The ndhE gene, which encodes NAD(P)H-quinone oxidoreductase subunit 4L, has been consistently identified in various Ipomoea species, including I. purpurea, I. nil, I. triloba, and I. pes-caprae . This conservation underscores the essential nature of this gene in chloroplast function and plant physiology.

Applications in Research and Biotechnology

Recombinant NAD(P)H-quinone oxidoreductase subunit 4L from Ipomoea purpurea has several potential applications in research and biotechnology.

Study of Chloroplast Function and Evolution

The availability of recombinant NAD(P)H-quinone oxidoreductase subunit 4L facilitates studies on chloroplast function and evolution. By investigating the structure and function of this protein, researchers can gain insights into the mechanisms of electron transport in chloroplasts and the evolutionary adaptations of photosynthetic organisms .

Investigation of Oxidative Stress Responses

Given the role of NAD(P)H-quinone oxidoreductases in oxidative stress responses, the recombinant protein can be used to study how plants cope with environmental stressors such as pollution, herbicides, and other xenobiotics. Such studies could provide valuable information for developing strategies to enhance plant resistance to various stressors .

Future Research Directions

Research on Recombinant Ipomoea purpurea NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic opens several promising avenues for future investigation.

Functional Studies in Planta

Studies investigating the function of NAD(P)H-quinone oxidoreductase subunit 4L in the context of the whole plant could reveal its role in various physiological processes, including photosynthesis, respiration, and responses to environmental stressors. Techniques such as gene silencing or CRISPR-Cas9-mediated gene editing could be employed to elucidate the in vivo function of this protein .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific format preferences. Please indicate your desired format in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard protocol includes 50% glycerol; you can use this as a reference point for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please let us know, and we will prioritize its development.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Ipomoea purpurea (Common morning glory) (Pharbitis purpurea)
Target Names
ndhE
Target Protein Sequence
MMLEYALVLSAFLFSIGIYGLITSRNMVRALMCLELILNAVNMNLVTFSYFFDNRQLKGD IFSIFIIAIAAAEAAIGLAIVSSIYRNRKSTRIDQSNLLNN
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone to quinones within the photosynthetic chain, potentially also contributing to a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor for the enzyme. NDH couples the redox reaction with proton translocation, thereby conserving redox energy in a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase and what is its role in plant systems?

NAD(P)H-quinone oxidoreductase functions as a key enzyme involved in defense against reactive forms of oxygen, particularly in chloroplasts where oxidative stress is common. The enzyme catalyzes the two- or four-electron reduction of quinones and other organic compounds, using either NADH or NADPH as reducing cofactors and requiring FAD as a prosthetic group . In plant systems, particularly in Ipomoea purpurea (morning glory), the chloroplastic NAD(P)H-quinone oxidoreductase subunit 4L plays crucial roles in:

The enzyme typically operates via a 'ping-pong' kinetic mechanism where the reduced pyridine nucleotide binds to the active site, reduces the flavin co-factor to FADH₂, and then the substrate binds and is reduced .

How does the chloroplastic NAD(P)H-quinone oxidoreductase differ from cytosolic NQO1?

While both enzymes catalyze similar reactions, they differ in several important aspects:

FeatureChloroplastic NAD(P)H-quinone oxidoreductaseCytosolic NQO1
Cellular locationChloroplastCytosol (approximately 90%)
Primary functionPhotosynthetic electron transportDetoxification and antioxidant defense
Expression regulationLight-responsive elementsNrf2-Keap1/ARE pathway
Substrate preferencePlastoquinonesVarious quinones and xenobiotics
Evolutionary originProkaryotic (cyanobacterial)Eukaryotic

Understanding these differences is essential when designing experiments targeting the specific chloroplastic isoform from Ipomoea purpurea.

What methods are recommended for expressing and purifying recombinant Ipomoea purpurea NAD(P)H-quinone oxidoreductase?

Successful expression and purification can be achieved through the following methodological approach:

  • Expression system selection: E. coli BL21(DE3) is recommended due to its high expression yield and compatibility with chloroplastic proteins. Include a chloroplast transit peptide removal during construct design as this sequence can interfere with proper folding.

  • Vector optimization: Incorporate a His-tag or other affinity tag to facilitate purification, preferably at the C-terminus to avoid interference with enzymatic activity.

  • Expression conditions: Induce at lower temperatures (16-18°C) for 16-18 hours to enhance solubility of the recombinant protein.

  • Purification protocol:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Ion exchange chromatography to remove contaminants

    • Size exclusion chromatography to ensure homogeneity

  • Activity preservation: Include FAD (5-10 μM) in all purification buffers to maintain enzymatic activity, as the cofactor can be lost during purification steps .

  • Storage conditions: Store with 10% glycerol at -80°C to preserve activity for extended periods.

What are the recommended assays for measuring NAD(P)H-quinone oxidoreductase activity in plant extracts?

Several complementary approaches can be used to accurately measure enzyme activity:

  • Spectrophotometric assays:

    • Monitor NADH or NADPH oxidation at 340 nm (ε = 6,220 M⁻¹cm⁻¹)

    • Use 2,6-dichlorophenolindophenol (DCPIP) as an electron acceptor and measure the decrease in absorbance at 600 nm

    • For specific quantification, use ubiquinone (CoQ) as substrate and monitor its reduction at 275 nm

  • Inhibitor-based confirmation:

    • Use dicoumarol (10-100 μM) as a specific inhibitor to confirm that the measured activity is indeed from NAD(P)H-quinone oxidoreductase

    • 5-methoxy-1,2-dimethyl-3-[(4-nitrophenoxy)methyl]indole-4,7-dione (ES936) can also be used as a mechanism-based inhibitor

  • In-gel activity stain:

    • Separate proteins by native PAGE

    • Incubate gel with NADH/NADPH and nitroblue tetrazolium (NBT)

    • Active enzyme will produce a blue-purple formazan precipitate

When working with plant extracts specifically from Ipomoea purpurea, include steps to remove phenolic compounds that can interfere with the assays by adding polyvinylpolypyrrolidone (PVPP) during extraction.

How can researchers effectively study the superoxide scavenging activity of NAD(P)H-quinone oxidoreductase?

Based on established methodologies, the following protocols can be implemented:

  • Dihydroethidium (DHE) oxidation assay:

    • Generate superoxide using xanthine/xanthine oxidase system

    • Monitor DHE oxidation at excitation/emission wavelengths of 480/580 nm

    • Add purified enzyme with NAD(P)H and measure inhibition of DHE oxidation

  • Pyrogallol auto-oxidation:

    • Measure the auto-oxidation rate of pyrogallol (100 μM) at 420 nm

    • Add enzyme with NAD(P)H and quantify reduction in auto-oxidation rate

  • Electron spin resonance (ESR) spectroscopy:

    • Use potassium superoxide as a direct superoxide source

    • Add ethoxycarbonyl-2-methyl-3,4-dihydro-2H-pyrrole-1-oxide as spin trap

    • Measure reduction in signal amplitude upon addition of enzyme and NAD(P)H

  • Cellular models:

    • Create isogenic cell lines with varying levels of enzyme expression

    • Compare superoxide levels using fluorescent probes (MitoSOX, hydroethidine)

    • Confirm specificity using enzyme inhibitors or siRNA knockdown

These methodologies should be adapted for plant-specific contexts when working with the Ipomoea purpurea chloroplastic isoform.

What considerations should be made when designing experiments to study the antioxidant properties of recombinant Ipomoea purpurea NAD(P)H-quinone oxidoreductase?

Several critical factors must be addressed:

  • Redox environment control:

    • Maintain reducing conditions during purification and assays (add DTT or β-mercaptoethanol)

    • Consider the impact of oxygen concentration on experimental outcomes

    • Include controls for spontaneous oxidation of substrates

  • Substrate selection:

    • For plastoquinone reduction studies, use synthesized analogs like decyl-plastoquinone

    • When studying vitamin E (α-tocopherol) interaction, use α-tocopherol-quinone as substrate

    • For comparative studies, test both endogenous (plant-derived) and standard laboratory quinones

  • Experimental models:

    • Design liposome systems to mimic chloroplast membranes for physiologically relevant assays

    • Consider using isolated chloroplasts or thylakoid membranes as more complex models

    • For whole-plant studies, use Arabidopsis thaliana as a model system with known cross-reactivity

  • Analytical approaches:

    • Employ HPLC to quantify reduction products

    • Use LC-MS/MS for comprehensive metabolite profiling

    • Consider proteomic analysis to identify interaction partners

  • Controls and validations:

    • Include enzymatically inactive mutants as negative controls

    • Validate findings across multiple experimental systems

    • Use specific inhibitors to confirm enzyme specificity

How can the role of NAD(P)H-quinone oxidoreductase in plant stress response be effectively investigated?

A comprehensive investigation requires multiple complementary approaches:

  • Gene expression analysis:

    • Quantify gene expression under various stress conditions (drought, high light, heat, pathogen attack)

    • Use qRT-PCR to measure transcript levels

    • Perform RNA-seq to identify co-regulated gene networks

  • Protein level assessment:

    • Develop specific antibodies against the Ipomoea purpurea isoform

    • Use western blotting to quantify protein levels under stress

    • Employ immunolocalization to determine subcellular redistribution

  • Functional studies:

    • Generate transgenic plants with altered expression levels

    • Assess stress tolerance phenotypes (ROS accumulation, lipid peroxidation, photosynthetic efficiency)

    • Perform metabolomics to identify changes in quinone and antioxidant profiles

  • In vivo activity measurement:

    • Develop methods to measure enzyme activity in intact chloroplasts

    • Use non-invasive fluorescence techniques when possible

    • Correlate activity with physiological responses

The activity of chloroplastic NAD(P)H-quinone oxidoreductase is especially relevant in high light stress conditions, when the risk of oxidative damage is greatest. Design experiments with appropriate light intensity controls and acclimation periods.

What are the methodological approaches for investigating potential interactions between NAD(P)H-quinone oxidoreductase and other components of plant antioxidant systems?

Several advanced techniques can reveal interaction networks:

Particular attention should be paid to interactions with ascorbate-glutathione cycle enzymes and thioredoxin-dependent systems, which are known to coordinate with NAD(P)H-dependent reductases in chloroplasts.

How can researchers effectively study the potential applications of Ipomoea purpurea NAD(P)H-quinone oxidoreductase in cancer research models?

Building on findings with other NQO1 enzymes, the following methodologies are recommended:

  • Cytotoxicity screening:

    • Test the effects of enzyme-activated quinone prodrugs on cancer cell lines

    • Use the MTT assay to measure cell viability in 2D and 3D culture models

    • Compare responses in cell lines with varying NQO1 expression levels

  • Mechanism of action studies:

    • Assess induction of apoptosis using dual acridine orange/ethidium bromide staining

    • Perform Annexin V-FITC/PI assays to quantify early vs. late apoptosis

    • Measure caspase-3 activity as an indicator of apoptotic pathway activation

  • Cell cycle analysis:

    • Use flow cytometry to determine effects on cell cycle progression

    • Investigate S-phase arrest similar to that observed with other plant extracts

    • Analyze expression of cell cycle regulatory proteins

  • Molecular pathway investigations:

    • Examine effects on intrinsic vs. extrinsic apoptotic pathways

    • Measure procaspase-8 (extrinsic) and procaspase-9 (intrinsic) cleavage

    • Investigate p53 stabilization, as NQO1 is known to affect this tumor suppressor

This approach leverages the known anticancer properties of Ipomoea purpurea extracts while focusing specifically on the contribution of NAD(P)H-quinone oxidoreductase mechanisms.

What are the common challenges in expressing functionally active recombinant chloroplastic NAD(P)H-quinone oxidoreductase and how can they be addressed?

Researchers frequently encounter several issues that can be systematically addressed:

  • Insoluble protein expression:

    • Lower induction temperature to 16-18°C

    • Use solubility-enhancing fusion tags (SUMO, MBP, TRX)

    • Consider cell-free expression systems for difficult constructs

    • Optimize codon usage for E. coli expression

  • Loss of FAD cofactor:

    • Supplement expression media with riboflavin

    • Add FAD to all purification buffers (5-10 μM)

    • Monitor the characteristic yellow color as an indicator of FAD retention

    • Measure A280/A450 ratio to assess FAD content

  • Protein instability:

    • Include protease inhibitors throughout purification

    • Add reducing agents to prevent oxidation-induced aggregation

    • Optimize buffer conditions (pH 7.0-7.5, 150-300 mM NaCl)

    • Consider addition of glycerol (10-20%) to stabilize the enzyme

  • Low activity recovery:

    • Test activity immediately after each purification step

    • Develop a rapid purification protocol to minimize time

    • Ensure anaerobic conditions when possible to prevent oxidative damage

    • Determine optimal storage conditions (typically -80°C with 10-20% glycerol)

How can researchers address the challenge of distinguishing between different isoforms of NAD(P)H-quinone oxidoreductase in plant systems?

Differentiation between isoforms requires targeted methodologies:

  • Antibody development:

    • Generate isoform-specific antibodies targeting unique epitopes

    • Validate antibody specificity using recombinant proteins and knockout lines

    • Use these for western blotting, immunoprecipitation, and immunolocalization

  • Activity-based discrimination:

    • Develop inhibitor profiles specific to each isoform

    • Use subcellular fractionation to separate chloroplastic and cytosolic enzymes

    • Employ different substrate preferences to distinguish activities

  • Genetic approaches:

    • Design isoform-specific primers for qRT-PCR analysis

    • Create reporter constructs with isoform-specific promoters

    • Generate CRISPR/Cas9 knockouts targeting specific isoforms

  • Mass spectrometry-based identification:

    • Identify unique peptide signatures for each isoform

    • Use targeted proteomics (SRM/MRM) for isoform quantification

    • Apply proteomic approaches to isolated organelles

These approaches are particularly important when studying Ipomoea purpurea, which may contain multiple NAD(P)H-quinone oxidoreductase isoforms with overlapping functions but distinct subcellular localizations.

What methods can be used to resolve contradictory data regarding NAD(P)H-quinone oxidoreductase function in plant systems?

Conflicting results can be addressed through systematic evaluation:

  • Standardization of experimental conditions:

    • Create detailed protocols for enzyme preparation and assays

    • Control for variables like pH, temperature, substrate concentration, and oxygen levels

    • Establish positive and negative controls for each assay system

  • Multi-method validation:

    • Employ complementary techniques to measure the same parameter

    • For superoxide scavenging, combine spectrophotometric, ESR, and cell-based assays

    • Cross-validate findings between in vitro and in vivo systems

  • Genetic confirmation:

    • Generate knockout/knockdown plants to confirm enzyme function

    • Create complementation lines expressing the wild-type or mutated enzyme

    • Perform rescue experiments with recombinant protein

  • Cross-species comparison:

    • Test the same hypotheses across different plant species

    • Include model systems with well-characterized NAD(P)H oxidoreductases

    • Consider evolutionary conservation of function across species

  • Collaborative validation:

    • Establish multi-laboratory validation of key findings

    • Share standardized materials (recombinant proteins, antibodies, plant lines)

    • Develop consensus protocols for activity measurements

What are the promising approaches for utilizing molecular evolution and protein engineering to enhance the functional properties of NAD(P)H-quinone oxidoreductase?

Several cutting-edge strategies show particular promise:

  • Directed evolution:

    • Apply error-prone PCR to generate variant libraries

    • Develop high-throughput screening methods based on quinone reduction

    • Select for enhanced stability, altered substrate specificity, or increased catalytic efficiency

  • Structure-guided engineering:

    • Use homology modeling based on related NQO structures

    • Identify key residues for substrate binding and catalysis

    • Design rational mutations to enhance desired properties

  • Domain swapping experiments:

    • Exchange domains between cytosolic and chloroplastic isoforms

    • Create chimeric proteins with altered localization or activity profiles

    • Identify minimal functional domains required for specific activities

  • Post-translational modification engineering:

    • Identify native modifications affecting enzyme function

    • Modify phosphorylation, acetylation, or other regulatory sites

    • Design variants resistant to oxidative inactivation

These approaches can lead to enzymes with enhanced stress protection capabilities for agricultural applications or improved properties for biocatalytic applications.

How can integrative 'omics approaches advance our understanding of NAD(P)H-quinone oxidoreductase function in Ipomoea purpurea?

A comprehensive multi-omics strategy would involve:

  • Transcriptomics:

    • Perform RNA-seq under various stress conditions

    • Identify co-expressed gene networks

    • Characterize alternative splicing patterns

  • Proteomics:

    • Map the protein-protein interaction network

    • Identify post-translational modifications

    • Quantify changes in protein abundance under stress

  • Metabolomics:

    • Profile quinone and hydroquinone levels

    • Track changes in antioxidant metabolites

    • Identify novel substrates or products

  • Phenomics:

    • Correlate enzyme activity with whole-plant phenotypes

    • Use high-throughput phenotyping to assess stress responses

    • Identify subtle phenotypic changes in mutant lines

  • Data integration:

    • Develop computational models linking gene expression, protein activity, and metabolite levels

    • Apply machine learning to identify patterns across datasets

    • Create predictive models of plant stress responses

This integrative approach would place NAD(P)H-quinone oxidoreductase function within the broader context of plant metabolism and stress response networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.