Recombinant Ipomoea purpurea Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

While no data exists for Ipomoea purpurea psbB, studies on related species highlight critical roles:

  • Chlorophyll Coordination: Histidines in transmembrane helices bind chlorophyll via axial ligands. Five chlorophylls are directly coordinated, while others are positioned for energy transfer .

  • Assembly and Stability: PsbB interacts with PsbH and PsbL during PSII biogenesis. In Synechocystis, unassembled psbB binds chlorophyll and β-carotene before integrating into the core complex .

Comparative Genomic Context

In Ipomoea species, plastome studies reveal:

  • Gene Arrangement: psbB is part of the psbB operon (psbB-psbT-psbH-petB-petD) in chloroplast genomes, ensuring coordinated expression of PSII and cytochrome b6f complex genes .

  • IR Contraction: Ipomoea plastomes exhibit reduced inverted repeats (IRs), potentially influencing gene duplication and expression efficiency .

Potential Research Gaps and Directions

  1. Structural Analysis: Cryo-EM or X-ray crystallography to resolve Ipomoea psbB’s pigmentation pattern.

  2. Functional Studies: Chlorophyll fluorescence kinetics to assess energy transfer efficiency in recombinant psbB.

  3. Evolutionary Insights: Comparative analysis of psbB sequences across Convolvulaceae to trace structural divergence.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Ipomoea purpurea (Common morning glory) (Pharbitis purpurea)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGLACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVAFYGGELNGVSYSDPTTVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFLKLGDPTTKRQAA
Uniprot No.

Target Background

Function

A core component of the photosystem II (PSII) complex, this chlorophyll-binding protein is crucial for catalyzing the initial light-driven photochemical reactions within PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, generating O₂ and a proton gradient essential for ATP synthesis.

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How is the psbB gene organized in the chloroplast genome of higher plants?

The psbB gene is part of a pentacistronic transcription unit in the chloroplast genome of vascular plants. This complex gene cluster encodes not only CP47 (psbB) but also other important photosynthetic components: subunits T (psbT) and H (psbH) of photosystem II, as well as cytochrome b6 (petB) and subunit IV (petD) of the cytochrome b6f complex . The expression of this gene cluster involves numerous post-transcriptional processing events, including splicing of group II introns found in petB and petD genes, RNA editing, and intercistronic processing that generates mono-, di-, and multicistronic transcripts . Additionally, the small subunit of photosystem II, PsbN, is encoded in the intercistronic region between psbH and psbT but is transcribed in the opposite direction, adding another layer of complexity to the regulation of this gene cluster .

What expression systems are commonly used for producing recombinant Ipomoea purpurea psbB protein?

Multiple expression systems can be employed to produce recombinant Ipomoea purpurea psbB protein, each with specific advantages depending on research requirements. Based on available information, the protein can be expressed in:

  • Yeast systems (designated by product code CSB-YP419791IND1)

  • Bacterial systems (E. coli, designated by product code CSB-EP419791IND1)

  • Insect cell systems using baculovirus vectors (designated by product code CSB-BP419791IND1)

  • Mammalian cell expression systems (designated by product code CSB-MP419791IND1)

The choice of expression system should be determined by experimental requirements such as need for post-translational modifications, protein folding considerations, yield requirements, and downstream applications. For structural studies requiring high yields, E. coli systems might be preferred, while mammalian systems may be more suitable when native folding and modifications are critical .

What factors influence post-transcriptional processing of the psbB gene, and how do they affect protein expression?

The expression of psbB involves complex post-transcriptional processes that are regulated by numerous specificity factors. In Chlamydomonas, the Mbb1 protein containing ten HAT motifs arranged in tandem (likely mediating protein-protein interactions) plays a critical role in psbB 5'-end processing and psbH processing/stability . Mbb1 functions as part of a 300 kDa complex and knockout mutants of mbb1 predominantly fail to accumulate the CP47 protein encoded by psbB, leading to broad defects in PSII complex assembly .

How do mutations in the psbB gene affect PSII assembly and function in comparative plant systems?

Mutations in the psbB gene produce system-wide effects on photosynthetic function across different plant species, though with varying severity. In Chlamydomonas, mbb1 mutants affecting psbB expression predominantly fail to accumulate CP47 and display broad defects in PSII complex assembly . These defects are more severe than those observed in Arabidopsis hcf107 mutants, which primarily affect psbH accumulation rather than psbB directly.

The differential effects observed between species suggest that regulatory networks and compensatory mechanisms vary significantly across plant systems. This has important implications for researchers using model organisms to study PSII assembly and function, as findings may not transfer directly between systems. When designing experiments to study psbB mutations, researchers should carefully consider species-specific differences in PSII assembly pathways and the potential for secondary effects on other photosystem components.

What methodological approaches are most effective for studying protein-protein interactions involving CP47 in photosystem II complexes?

Several methodological approaches can be used to study protein-protein interactions involving CP47 in PSII complexes:

  • Co-immunoprecipitation with tagged variants: Using recombinant CP47 with specific tags (such as the available Avi-tag biotinylated version ) allows for efficient pull-down experiments to identify interacting partners.

  • Cross-linking coupled with mass spectrometry: This approach can capture transient interactions within the photosystem complex by covalently linking proteins that are in close proximity before analysis.

  • Blue native PAGE: This technique preserves native protein complexes and can be used to separate intact PSII complexes of different compositions, which can then be analyzed by second-dimension SDS-PAGE to identify individual components.

  • Förster resonance energy transfer (FRET): By tagging CP47 and potential interacting partners with appropriate fluorophores, researchers can detect proximity-based energy transfer indicating direct interaction.

  • Yeast two-hybrid or split-GFP systems: Though challenging for membrane proteins, modified versions of these systems can be used to screen for direct interactions with specific domains of CP47.

When implementing these approaches, researchers should consider the membrane-bound nature of CP47 and its integration within the PSII complex, which may necessitate specialized protocols for membrane protein analysis.

How can researchers quantitatively assess the impact of CP47 variants on photosynthetic efficiency?

Quantitative assessment of CP47 variants on photosynthetic efficiency requires a multi-parameter approach:

When assessing CP47 variants, researchers should compare multiple parameters to obtain a comprehensive picture of the functional impact. Control experiments using wild-type protein under identical conditions are essential for proper interpretation. For recombinant variants, reconstitution experiments in CP47-depleted membrane systems can provide direct evidence of functional differences.

What is the relationship between CP47 structure and the binding of chlorophyll molecules in the PSII complex?

CP47 serves as an internal antenna system for PSII, with its structure specifically evolved to coordinate multiple chlorophyll molecules in precise orientations for efficient excitation energy transfer to the reaction center. The protein contains transmembrane helices that create a scaffold for binding chlorophyll molecules through specific amino acid residues, particularly histidines that coordinate the central magnesium ions of chlorophyll.

Studies of CP47 indicate that it binds approximately 16 chlorophyll a molecules and several carotenoids. The spatial arrangement of these pigments is critical for the directionality of energy transfer, with the closest chlorophylls to the reaction center facilitating the final energy transfer steps. Mutations affecting key amino acids involved in chlorophyll binding can disrupt this precise arrangement, leading to reduced energy transfer efficiency or increased non-productive energy dissipation.

What are the optimal conditions for expressing and purifying functional recombinant Ipomoea purpurea CP47 protein?

Expressing and purifying functional CP47 presents significant challenges due to its membrane-integrated nature and requirement for chlorophyll binding. Based on the available expression systems , researchers should consider:

  • Expression system selection: While E. coli systems (CSB-EP419791IND1) may provide higher yields, they lack the chloroplast-specific machinery for proper folding and chlorophyll incorporation. For functional studies, insect cell (CSB-BP419791IND1) or mammalian cell (CSB-MP419791IND1) systems may produce more native-like protein .

  • Solubilization and purification: Membrane proteins require careful selection of detergents for solubilization. A step-wise approach is recommended:

    • Initial solubilization with stronger detergents like dodecyl maltoside (DDM)

    • Transition to milder detergents like digitonin for later purification steps

    • Consider nanodiscs or amphipols for final stabilization of the purified protein

  • Chlorophyll reconstitution: For functional studies, reconstitution with chlorophyll a may be necessary after purification, requiring careful optimization of chlorophyll:protein ratios and reconstitution conditions.

  • Tag selection and placement: The available biotinylated Avi-tag version (CSB-EP419791IND1-B) offers advantages for purification using streptavidin affinity, but tag placement must be carefully considered to avoid interfering with protein folding or function.

  • Quality control: Assess protein functionality through chlorophyll binding (absorbance spectrum), secondary structure (circular dichroism), and homogeneity (size exclusion chromatography).

How can researchers effectively design experiments to study pleiotropy in photosynthetic proteins like CP47?

Studying pleiotropy in photosynthetic proteins requires multifaceted experimental approaches that can distinguish direct from indirect effects. An effective experimental design should incorporate:

  • Genetic approaches: Create precise mutations or deletions in the psbB gene using CRISPR-Cas9 or similar techniques, targeting specific domains or functional regions rather than generating knockout mutants that may have broad effects.

  • Temporal analysis: Monitor the sequence of events following mutation or deletion, as this can help distinguish primary effects from secondary consequences. For example, monitoring changes in transcript levels, protein accumulation, and complex assembly over time after induction of a conditional mutation.

  • Complementation studies: Use recombinant wild-type and mutant proteins to rescue mutant phenotypes, allowing assessment of specific protein functions.

  • Systems biology approach: Combine transcriptomics, proteomics, and metabolomics to capture the full range of effects resulting from psbB mutation, including unexpected changes in seemingly unrelated pathways.

  • Comparative analysis: Study similar mutations across different species (e.g., comparing effects in Arabidopsis and Chlamydomonas as seen with hcf107 and mbb1 mutations ) to identify conserved versus species-specific pleiotropic effects.

Research on flower color in Ipomoea purpurea provides a useful model for understanding pleiotropy, as studies have shown that mutations affecting flower color (such as the white-flowered a allele) can have pleiotropic effects on traits like selfing rates and survival from germination to flowering . Similar comprehensive approaches should be applied when studying pleiotropy in photosynthetic proteins like CP47.

What are the most effective techniques for resolving the structure of CP47 in its native membrane environment?

Resolving membrane protein structures like CP47 in native-like environments requires specialized approaches:

TechniqueAdvantagesLimitationsSample Preparation Considerations
Cryo-Electron Microscopy (cryo-EM)Works with larger complexes; preserves native state; doesn't require crystallizationLower resolution for smaller proteins; requires homogeneous sampleProtein must be stable in thin ice layer; detergent choice critical
X-ray CrystallographyHighest resolution possible; well-establishedDifficult to crystallize membrane proteins; crystal packing forces may distort structureLCP (Lipidic Cubic Phase) crystallization often superior for membrane proteins
Solid-State NMRCan study proteins in membrane bilayers; provides dynamic informationSize limitations; requires isotope labelingSample preparation less disruptive to native structure compared to solution NMR
Hydrogen/Deuterium Exchange Mass SpectrometryMaps solvent-accessible regions; works with limited materialDoesn't provide atomic resolutionCan be performed on intact complexes without need for crystallization
Electron Paramagnetic Resonance (EPR)Excellent for studying paramagnetic centers and distances between spin labelsRequires introduction of spin labelsStrategic placement of spin labels needed to maximize structural information

How does the structure of CP47 from Ipomoea purpurea compare to its homologs in other photosynthetic organisms?

While specific structural data for Ipomoea purpurea CP47 is limited in the search results, comparative analysis between CP47 proteins from different organisms reveals important conservation and divergence patterns. CP47 is generally highly conserved across photosynthetic organisms due to its fundamental role in photosystem II function, but species-specific differences exist that may reflect adaptations to different light environments or regulatory mechanisms.

Previous research has shown that regulatory mechanisms for CP47 expression differ between species. For example, the Mbb1 protein in Chlamydomonas and its ortholog HCF107 in Arabidopsis both affect CP47 accumulation but through somewhat different mechanisms, with mbb1 mutations having broader effects on PSII assembly compared to hcf107 mutations . These regulatory differences may correlate with subtle structural adaptations in the CP47 protein itself.

For researchers studying Ipomoea purpurea CP47, homology modeling based on high-resolution structures from other organisms (such as cyanobacteria or spinach) would be a valuable approach to predict structural features, followed by targeted experimental validation of key regions where sequence divergence suggests functional differences.

What strategies can researchers employ when facing low expression yields of recombinant CP47 protein?

When facing low expression yields of recombinant CP47, researchers can implement several strategies:

  • Optimize codon usage: Adapt the coding sequence to the preferred codons of the expression host without changing the amino acid sequence.

  • Adjust expression conditions: Systematic optimization of:

    • Induction timing and temperature (lower temperatures often improve membrane protein folding)

    • Media composition (specialized media for membrane proteins may help)

    • Inducer concentration (lower concentrations may reduce aggregation)

    • Cell density at induction (typically OD600 0.4-0.8 for membrane proteins)

  • Expression as fusion protein: Consider fusion partners known to enhance membrane protein expression, such as Mistic, SUMO, or MBP, with appropriate protease cleavage sites.

  • Switch expression systems: If E. coli yields remain poor, consider alternative systems available for this protein such as yeast, insect cells, or mammalian cells as indicated in the product information .

  • Express functional domains: For some studies, expressing individual domains rather than the full-length protein may improve yields while still providing valuable information.

  • Use specialized E. coli strains: Strains like C41(DE3), C43(DE3), or Lemo21(DE3) are engineered specifically for membrane protein expression.

  • Screen detergents early: Adding mild detergents during cell lysis can improve extraction efficiency; systematic screening of different detergents is recommended.

How can researchers differentiate between direct and indirect effects when studying CP47 mutations in photosynthetic function?

Differentiating between direct and indirect effects of CP47 mutations requires a systematic experimental approach:

  • Time-course analyses: Monitor changes immediately following induction of a conditional mutation or deletion. Primary effects typically manifest first, followed by secondary consequences.

  • Dose-dependent studies: If using inducible or partial knockdown systems, establish whether effects scale proportionally with CP47 reduction (suggesting direct relationships) or emerge suddenly below a threshold (suggesting indirect effects).

  • Targeted complementation: Use site-directed mutagenesis to create variants affecting specific functions (e.g., chlorophyll binding vs. protein-protein interaction sites) to determine which molecular functions correlate with specific phenotypes.

  • In vitro reconstitution: Isolate the effects by reconstituting purified wild-type or mutant CP47 into defined membrane systems, eliminating the complexity of the cellular environment.

  • Comparative mutant analysis: Compare the effects of CP47 mutations to mutations in interacting proteins. Shared phenotypes may indicate effects on the same pathway rather than direct consequences of CP47 dysfunction.

  • Suppressor screens: Identify mutations that suppress the effects of CP47 mutations, which can reveal compensatory pathways and distinguish primary from secondary effects.

  • Mathematical modeling: Develop kinetic models of photosynthetic electron transport that incorporate measured parameters to predict direct consequences of CP47 alterations versus system-level adaptations.

What emerging techniques show promise for studying the dynamic interactions of CP47 within the photosynthetic apparatus?

Several cutting-edge approaches are transforming our ability to study dynamic interactions of photosynthetic proteins like CP47:

  • Single-molecule FRET: Allows observation of conformational changes and protein interactions at the individual molecule level, revealing heterogeneity masked in ensemble measurements.

  • Time-resolved cryo-EM: Captures different states of protein complexes, potentially revealing the dynamic assembly process of PSII and the incorporation of CP47.

  • In-cell NMR spectroscopy: Provides structural information in the cellular context, potentially revealing how CP47 interactions differ in native versus recombinant systems.

  • Mass photometry: This emerging technique measures the mass of individual particles in solution, enabling direct observation of complex assembly states and stoichiometry without labeling.

  • Integrative structural biology approaches: Combining multiple techniques (crystallography, cryo-EM, crosslinking mass spectrometry, etc.) with computational modeling to generate comprehensive structural models that capture dynamic aspects.

  • Advanced fluorescence lifetime imaging: Can track energy transfer pathways in intact cells, revealing how CP47 functions within the complete photosynthetic apparatus.

  • Optogenetic approaches: Light-controlled protein interaction systems could be adapted to study the regulation of CP47 incorporation into PSII complexes.

For researchers studying Ipomoea purpurea CP47, these approaches could reveal species-specific adaptations in photosystem assembly and function, potentially correlating with the unique ecological niche of this plant species.

How might research on CP47 from Ipomoea purpurea contribute to improving photosynthetic efficiency in crop plants?

Understanding CP47 from diverse species like Ipomoea purpurea has significant implications for agricultural applications:

  • Comparative functional analysis: Differences in CP47 structure and function between Ipomoea purpurea and crop species may reveal natural variations that correlate with photosynthetic efficiency under different environmental conditions. These variations could inform targeted engineering of crop CP47 proteins.

  • Stress resistance mechanisms: Morning glory species like Ipomoea purpurea are known for environmental resilience. Studying how their photosynthetic apparatus, including CP47, maintains function under stress conditions could identify adaptive features transferable to crops.

  • Optimized light harvesting: The arrangement of chlorophyll molecules in CP47 affects light energy capture and transfer. Natural variants in Ipomoea purpurea adapted to different light environments could inform redesigns of crop photosystems for specific agricultural settings.

  • Regulatory network insights: Understanding the complex post-transcriptional processes controlling psbB expression could reveal leverage points for enhancing CP47 production and PSII assembly in crops under suboptimal conditions.

  • Pleiotropic effect management: Research on pleiotropic effects in Ipomoea purpurea, such as those observed with flower color mutations , provides a model for understanding how modifications to photosynthetic proteins might have unexpected consequences that need management in crop improvement programs.

By integrating findings from diverse species like Ipomoea purpurea into photosynthesis engineering efforts, researchers may identify novel approaches to overcome the conserved limitations of crop photosynthesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.