Recombinant Ippy virus Pre-glycoprotein polyprotein GP complex (GPC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GPC; GP-C; Pre-glycoprotein polyprotein GP complex; Pre-GP-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
264-495
Protein Length
Full Length of Mature Protein
Species
Ippy mammarenavirus (isolate Rat/Central African Republic/Dak An B 188 d/1970) (IPPYV)
Target Names
GPC
Target Protein Sequence
STFTWSLSDSSGTENPGGYCLTRWMLFAADLKCFGNTAIAKCNLNHDEEFCDMLRLIDFN KQALKTFKSEVNHGLQLITKAINALINDQLIMKNHLRDLMGIPYCNYSKFWYLNDTRTGR VSLPKCWMISNGTYLNETHFSDEIEQEADNMITEMLRKEYQERQGKTPLGLVDLFIFSTS FYSITVFLHLIKIPTHRHIVGQGCPKPHRLNSRAICSCGAYKQPGLPTKWKR
Uniprot No.

Target Background

Function

This recombinant Ippy virus pre-glycoprotein polyprotein GP complex (GPC) interacts with the host receptor, mediating viral attachment to host receptor alpha-dystroglycan (DAG1). This interaction facilitates virion entry into the host cell via the endosomal pathway. As a class I viral fusion protein, GPC directs the fusion of viral and host endosomal membranes, delivering the nucleocapsid into the cytoplasm. Membrane fusion is triggered by irreversible conformational changes induced by endosomal acidification. The stable signal peptide (SSP) component is cleaved, functioning as a signal peptide while also remaining integrated as the third component of the GP complex. The SSP is essential for efficient glycoprotein expression, post-translational maturation cleavage of GP1 and GP2, glycoprotein transport to the cell surface, infectious virion formation, and acid pH-dependent glycoprotein-mediated cell fusion.

Database Links

KEGG: vg:3953117

Protein Families
Arenaviridae GPC protein family
Subcellular Location
[Glycoprotein G1]: Virion membrane; Peripheral membrane protein. Host endoplasmic reticulum membrane; Peripheral membrane protein. Host Golgi apparatus membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein.; [Glycoprotein G2]: Virion membrane; Single-pass membrane protein. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein. Host cell membrane; Single-pass membrane protein.; [Stable signal peptide]: Virion membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein.

Q&A

What is the composition and processing of arenavirus GPC?

The arenavirus glycoprotein complex is initially synthesized as a single polypeptide precursor (GPC) that undergoes multiple post-translational modifications. The mature GPC consists of three subunits: the stable signal peptide (SSP), the receptor-binding subunit GP1, and the transmembrane fusion subunit GP2. Unlike conventional signal peptides that are degraded after directing proteins to the endoplasmic reticulum, the arenavirus SSP remains stably associated with the mature glycoprotein complex and plays essential roles in GPC function .

The maturation process involves two critical proteolytic cleavage events:

  • Cleavage of the SSP from the G1-G2 precursor by cellular signal peptidase in the endoplasmic reticulum

  • Cleavage of the G1-G2 precursor by the cellular subtilisin kexin isozyme-1/site-1 protease (SKI-1/S1P) in the Golgi apparatus to generate the mature GP1 and GP2 subunits

This proteolytic processing is essential for GPC function, as only the fully processed complex can mediate membrane fusion during viral entry. While the unprocessed precursor can be transported to the plasma membrane, only mature GPC is incorporated into virions, suggesting a selective mechanism for virion assembly .

What roles does the stable signal peptide (SSP) play in arenavirus GPC function?

The SSP of arenavirus GPC is unusually long (58 amino acids) and serves multiple critical functions beyond its initial role in directing the protein to the endoplasmic reticulum:

  • Membrane topology determination: The SSP spans the membrane twice, with both N- and C-termini in the cytosol .

  • GPC expression and maturation: SSP is required for efficient glycoprotein expression and post-translational processing .

  • Transport regulation: SSP facilitates transport of the glycoprotein complex to the cell surface plasma membrane .

  • Structural stabilization: SSP helps stabilize the spike complex in its native conformation .

  • Fusion activity regulation: SSP is essential for the acid pH-dependent membrane fusion activity of GPC during viral entry .

  • Virion morphogenesis: SSP is required for the formation of infectious virus particles .

Mutations in conserved residues of the SSP can have profound effects on these functions. For instance, studies with Pichinde virus (PICV) demonstrated that certain SSP mutations significantly impair membrane fusion activity (G2A, Q3A, K33A, F49A, C57A), while others affect viral virulence in vivo (N20A, N37A, R55A) without dramatically altering fusion function .

What experimental systems are available for studying arenavirus GPC function?

Researchers have developed multiple experimental systems to study arenavirus GPC structure and function:

  • GPC expression systems: Transfection of cells with GPC expression vectors (e.g., pCAGGS-PICV-GPC) allows for analysis of GPC processing, cell surface expression, and fusion activity .

  • Pseudotyped virus-like particles (VLPs): These systems typically use a three-plasmid approach:

    • HIV-1 genome lacking packaging signal and envelope gene (e.g., pCMVRΔ8.91)

    • Reporter gene construct containing HIV packaging signal (e.g., pHR'GFP)

    • GPC expression vector

    This system enables quantitative assessment of GPC-mediated entry through reporter gene expression and normalization by HIV-1 p24 capsid protein levels .

  • Reverse genetics systems: For arenaviruses like PICV, complete reverse genetics systems allow generation of recombinant viruses with specific mutations in GPC for studying their effects in the context of the full viral life cycle .

  • Animal models: Guinea pigs have been established as a model for studying arenavirus pathogenesis and GPC function in vivo .

The choice of experimental system depends on the specific research question, with cell-based systems providing insights into basic molecular mechanisms and animal models enabling study of in vivo relevance.

How can researchers analyze GPC microdomain formation and organization?

Arenavirus GPC forms distinct microdomains on the cell surface that are important for viral assembly and budding. Several techniques can be employed to characterize these microdomains:

  • Immunogold electron microscopy: This technique allows visualization of GPC microdomains on the cell surface. Studies with Junín virus (JUNV) GPC demonstrated clustering into discrete microdomains of 120-160 nm in diameter .

  • Detergent solubility assays: Treatment of cells with cold Triton X-100 followed by centrifugation can separate detergent-resistant membrane fractions (associated with lipid rafts) from soluble fractions. For JUNV GPC, microdomains are soluble in cold Triton X-100, distinguishing them from conventional lipid rafts used by many other viruses .

The protocol typically involves:

  • Collection of cells expressing GPC

  • Lysis in TNE buffer containing 1% Triton X-100 at 4°C

  • Adjustment to 40% sucrose and overlaying with 30% and 5% sucrose solutions

  • Ultracentrifugation and collection of fractions

  • Western blot analysis of fractions with appropriate antibodies

  • Dual-label immunogold staining: This approach can be used to study colocalization of GPC with other viral components, such as the matrix protein Z .

These approaches have revealed that GPC microdomain formation is independent of SSP myristoylation and does not require coexpression with the viral matrix protein Z, suggesting intrinsic properties of GPC drive this organization .

What approaches are used to generate and characterize recombinant arenaviruses with GPC mutations?

Generation of recombinant arenaviruses with specific GPC mutations involves several key steps:

  • Site-directed mutagenesis: Introduction of specific mutations in the GPC coding sequence within the viral S segment plasmid .

  • Reverse genetics rescue: Transfection of cells (typically BSRT7-5 cells expressing T7 RNA polymerase) with plasmids encoding the viral L and mutated S segments .

  • Virus collection and amplification: Collection of supernatants from transfected cells at various time points, followed by plaque assays to isolate and amplify individual viral clones .

  • Sequence confirmation: RT-PCR and sequencing to confirm the presence of the desired mutations in the rescued viruses .

  • Characterization of mutant viruses:

    • Growth curve analysis in cell culture (e.g., BHK-21 cells)

    • Plaque morphology assessment

    • Virulence testing in animal models (e.g., guinea pigs)

This approach has been successfully used with PICV to identify SSP residues critical for viral replication and virulence. For example, mutations in conserved SSP residues G2, Q3, K33, F49, and C57 prevented recovery of infectious viruses, indicating their essential role in viral viability. In contrast, mutations N20A, N37A, and R55A allowed virus recovery but showed altered phenotypes in vitro and/or in vivo .

How can researchers analyze GPC cell surface expression and processing?

Analysis of GPC cell surface expression and processing typically involves the following methodologies:

Cell Surface Expression Analysis by Flow Cytometry:

  • Transfect cells (e.g., 293T) with GPC expression constructs

  • After 48 hours, fix cells with 4% paraformaldehyde for 5 minutes

  • Wash with PBS and block with 1% bovine serum albumin for 1 hour at 4°C

  • Incubate with primary antibody (e.g., guinea pig anti-PICV serum) overnight at 4°C

  • Wash three times with PBS

  • Incubate with fluorescently labeled secondary antibody (e.g., Alexa Fluor 488-labeled anti-guinea pig antibody) for 1 hour

  • Wash three times with PBS and analyze by flow cytometry

GPC Processing Analysis by Western Blotting:

  • Harvest cells expressing GPC

  • Prepare cell lysates and perform protein deglycosylation with PNGase F if needed

  • Resolve proteins by SDS-PAGE under reducing conditions

  • Transfer to nitrocellulose membrane

  • Block with appropriate buffer (e.g., TBS with 0.1% Tween 20 and 5% dry milk)

  • Probe with specific antibodies (e.g., anti-G2 monoclonal antibody F106G3)

  • Detect with HRP-conjugated secondary antibody and chemiluminescence

This combination of techniques allows assessment of both the transport of GPC to the cell surface and its proteolytic processing, providing insights into how specific mutations might affect these aspects of GPC biology.

How can pseudotyped virus-like particles be utilized to study GPC-mediated entry?

Pseudotyped virus-like particles (VLPs) provide a powerful tool for studying GPC-mediated entry without the biosafety concerns associated with infectious arenaviruses. The methodology typically involves:

Production of GPC-pseudotyped VLPs:

  • Co-transfect 293T cells with three plasmids:

    • HIV-1 genome plasmid lacking packaging signal and envelope gene (e.g., pCMVRΔ8.91)

    • Reporter plasmid containing HIV packaging signal and reporter gene (e.g., pHR'GFP)

    • GPC expression plasmid (wild-type or mutant)

  • Collect supernatants up to 96 hours post-transfection

  • Filter through 0.45-μm filter

  • Purify VLPs by sucrose gradient ultracentrifugation

  • Resuspend in appropriate medium, aliquot, and store at -80°C

  • Normalize VLP quantities by HIV p24 content via Western blotting

Entry Assay:

  • Transduce target cells with normalized amounts of VLPs

  • Assess reporter gene expression (e.g., GFP) by flow cytometry after an appropriate incubation period

  • Compare entry efficiency between wild-type and mutant GPC-pseudotyped VLPs

This system has been valuable for examining how specific mutations in GPC affect viral entry. For example, mutations in certain conserved SSP residues (G2A, Q3A, K33A, F49A, C57A) severely reduced GPC-mediated entry, while others (N20A, N37A, R55A) had less dramatic effects .

What are the current challenges in developing antivirals targeting arenavirus GPC?

The development of antivirals targeting arenavirus GPC faces several significant challenges:

  • Genetic diversity: The genetic diversity among arenavirus species creates challenges for developing broadly effective inhibitors. This diversity supports the continued emergence of new pathogens that may evade targeted therapeutics .

  • Structural complexity: The unique tripartite structure of arenavirus GPC (SSP-GP1-GP2) and the unusual role of the stable signal peptide make it structurally distinct from other viral fusion proteins, requiring specialized approaches .

  • Limited high-resolution structural data: While functional studies have identified critical regions and residues, comprehensive high-resolution structural information for the entire GPC complex remains limited.

  • Biosafety concerns: Work with pathogenic arenaviruses requires high-containment facilities, complicating drug screening and development efforts.

Despite these challenges, GPC remains a promising antiviral target due to its essential role in viral entry. Current and future research directions include:

  • Development of fusion inhibitors targeting the pH-dependent conformational changes in GPC

  • Small molecules targeting the unique SSP-GP2 interface

  • Inhibitors of host proteases required for GPC processing (e.g., SKI-1/S1P inhibitors)

  • Broadly neutralizing antibodies targeting conserved epitopes in GP1 or GP2

How do findings from model arenaviruses inform our understanding of pathogenic arenavirus GPC function?

Model arenaviruses like PICV provide valuable insights into the biology of highly pathogenic arenaviruses while allowing work under lower biosafety levels. Key translational findings include:

These findings from model systems have directly informed therapeutic approaches against pathogenic arenaviruses, highlighting the translational value of fundamental research with less hazardous viral models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.