Recombinant Iron import ATP-binding/permease protein IrtB (irtB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Iron Import ATP-Binding/Permease Protein IrtB (IrtB)

Recombinant IrtB is a heterologously expressed protein derived from Mycobacterium tuberculosis or related species, engineered for research and therapeutic applications. It functions as a component of the IrtAB ABC transporter, a heterodimeric complex critical for iron acquisition in mycobacteria. IrtB forms part of the transmembrane domain (TMD) and nucleotide-binding domain (NBD) architecture, enabling ATP-dependent import of iron-bound siderophores like mycobactin and carboxymycobactin .

Role in Iron Uptake

IrtAB imports iron-loaded siderophores via an ATP-dependent mechanism, with IrtB contributing to substrate recognition and translocation:

  • Substrate Preference: IrtAB preferentially transports Fe-MBT over Fe-cMBT, as shown by ATPase assays and growth complementation studies .

  • ATP Hydrolysis Dependency: Mutations abolishing ATPase activity (e.g., 2xEQ mutant) impair iron uptake, confirming ATP-driven transport .

Siderophore Reduction and Iron Release

While IrtA’s siderophore interaction domain (SID) catalyzes Fe³⁺ reduction, IrtB’s role in this process is indirect:

  • Fe-MBT Reduction: The SID reduces membrane-embedded Fe-MBT, releasing Fe²⁺ into the cytoplasm .

  • Fe-cMBT Uptake: IrtB alone (without IrtA) can import Fe-cMBT, but Fe²⁺ release requires cytoplasmic reductases .

Virulence and Pathogenicity Studies

IrtAB is essential for M. tuberculosis survival in iron-depleted environments (e.g., host macrophages):

  • Growth Defects: Deletion mutants (ΔirtA/irtB) show impaired replication in macrophages and mice, highlighting IrtB’s role in pathogenicity .

Comparative Analysis of IrtB Variants

VariantSpeciesTagKey Application
RFL19141MFMycobacterium bovisHisIron uptake mechanism studies
RFL7136HFHumanHisStructural homology modeling
IrtABΔSIDM. tuberculosisNativeSiderophore reduction assays

Challenges and Future Directions

  • Limited Solubility: Recombinant IrtB requires membrane reconstitution for functional studies, complicating in vitro assays .

  • Species-Specific Differences: Human IrtB homologs (e.g., RFL7136HF) may lack the siderophore import function observed in mycobacterial orthologs .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference point for your own preparations.
Shelf Life
The shelf life of the product is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development accordingly.
Synonyms
irtB; BQ2027_MB1384; Mycobactin import ATP-binding/permease protein IrtB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-579
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
irtB
Target Protein Sequence
MIRTWIALVPNDHRARLIGFALLAFCSVVARAVGTVLLVPLMAALFGEAPQRAWLWLGWL SAATVAGWVLDAVTARIGIELGFAVLNHTQHDVADRLPVVRLDWFTAENTATARQAIAAT GPELVGLVVNLVTPLTSAILLPAVIALALLPISWQLGVAALAGVPLLLGALWASAAFARR ADTAADKANTALTERIIEFARTQQALRAARRVEPARSLVGNALASQHTATMRLLGMQIPG QLLFSIASQLALIVLAGTTAALTITGTLTVPEAIALIVVMVRYLEPFTAVSELAPALEST RATLGRIGSVLTAPVMVAGSGTWRDGAVVPRIEFDDVAFGYDGGSGPVLDGVSFCLQPGT TTAIVGPSGCGKSTILALIAGLHQPTRGRVLIDGTDVATLDARAQQAVCSVVFQHPYLFH GTIRDNVFAADPGASDDQFAQAVRLARVDELIARLPDGANTIVGEAGSALSGGERQRVSI ARALLKAAPVLLVDEATSALDAENEAAVVDALAADPRSRTRVIVAHRLASIRHADRVLFV DDGRVVEDGSISELLTAGGRFSQFWRQQHEAAEWQILAE
Uniprot No.

Target Background

Function
Recombinant Iron import ATP-binding/permease protein IrtB (irtB) is part of the ABC transporter complex IrtAB involved in the import of iron-bound mycobactin (Fe-MBT) and carboxymycobactin (Fe-cMBT). Transmembrane domains (TMD) form a pore in the membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Protein Families
ABC transporter superfamily, Siderophore-Fe(3+) uptake transporter (SIUT) (TC 3.A.1.21) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of IrtB and how does it differ from IrtA?

IrtB (Rv1349) is characterized by five transmembrane segments at its N-terminal region, followed by cytoplasmic ATPase domains. Unlike IrtA (Rv1348), which possesses an N-terminal substrate binding domain (SBD) representing an atypical subset of ABC transporters, IrtB harbors only the permease and ATPase domains. The protein contains signature sequence motifs including WA 365GPSGCGKST373, WB 491LLVDEATSALD501, and SM 470LSGGERQ476 that are characteristic of ABC transporters .

Experimental characterization of IrtB structure typically requires membrane protein purification techniques including detergent solubilization, followed by structural analysis using X-ray crystallography or cryo-electron microscopy. For functional studies, researchers should consider liposome reconstitution experiments to maintain the native transmembrane configuration.

What is the functional relationship between IrtB and other iron-regulated proteins in M. tuberculosis?

IrtB operates within a tripartite system involving IrtA (Rv1348) and Rv2895c to facilitate iron acquisition in M. tuberculosis. The system functions through a division of labor where IrtA serves as a carboxymycobactin (cMyco) exporter, while IrtB and Rv2895c work together as a two-component importer of ferrated siderophores .

Methodologically, this functional relationship has been established through several approaches:

  • Protein-protein interaction studies (GST pull-down assays)

  • In vitro liposome reconstitution experiments

  • Knockout studies in model organisms such as Mycobacterium smegmatis

The data demonstrate that IrtB specifically interacts with ferrated siderophore-bound Rv2895c via its permease domain, with this interaction being dependent on the presence of detergent (Triton X-100) in the experimental buffer, suggesting the importance of maintaining the hydrophobic transmembrane domain structure .

How can researchers design optimal experimental conditions to study IrtB-Rv2895c interactions?

The interaction between IrtB and Rv2895c occurs specifically when Rv2895c is bound to ferrated carboxymycobactin (Fe-cMyco). To study this interaction effectively, researchers should:

  • Express and purify recombinant IrtB with appropriate tags (e.g., GST) while maintaining the integrity of transmembrane domains

  • Pre-load recombinant Rv2895c with Fe-cMyco before interaction studies

  • Include appropriate detergents (like Triton X-100) in buffers to stabilize the hydrophobic transmembrane domains

  • Utilize control experiments including GST-only and unliganded Rv2895c to confirm specificity

Research has shown that without Triton X-100 in the buffer, the interaction between IrtB and Rv2895c is not observable, indicating that the hydrophobic transmembrane domain is crucial for this interaction . Additionally, while Fe-cMyco-loaded Rv2895c shows strong interaction with IrtB, unliganded Rv2895c shows no interaction, and cMyco-loaded Rv2895c shows only feeble interaction, highlighting the specificity of this system.

What experimental design approaches are most effective for evaluating IrtB function in iron transport?

Single-Subject Experimental Design (SSED) approaches, particularly ABAB designs, can be valuable for studying IrtB function in controlled conditions. In an ABAB design:

A - Baseline measurements (iron uptake without recombinant IrtB)
B - Measurements during intervention (iron uptake with recombinant IrtB)
A - Return to baseline (removal of recombinant IrtB)
B - Reintroduction of intervention (reintroduction of recombinant IrtB)

This reversal design provides robust evidence of causality by demonstrating that changes in iron transport correlate specifically with the presence and absence of functional IrtB. For cellular studies, researchers may utilize:

  • In vitro liposome reconstitution with purified proteins

  • Gene knockout/complementation in model mycobacteria

  • Fluorescent or radioisotope-labeled siderophores to track transport

The advantage of the ABAB design is that it provides multiple experimental controls within a single system, allowing researchers to conclusively determine if observed effects are directly attributable to IrtB activity .

What are the optimal expression systems for producing functional recombinant IrtB?

Producing functional recombinant IrtB presents unique challenges due to its membrane-embedded nature. Several expression systems can be considered:

  • E. coli-based systems:

    • BL21(DE3) strains with pET vectors for high expression

    • C41(DE3) or C43(DE3) strains specifically designed for membrane proteins

    • Fusion tags: N-terminal GST tags have been successfully used for pull-down assays

  • Mycobacterial expression systems:

    • M. smegmatis expression for more native-like post-translational modifications

    • Inducible promoters to control expression levels

  • Cell-free expression systems:

    • Particularly useful for toxic membrane proteins

    • Can be directly incorporated into liposomes

The experimental evidence indicates that GST-tagged IrtB remains functional for interaction studies, but researchers must ensure the inclusion of appropriate detergents to maintain the integrity of transmembrane domains . Verification of proper folding should be assessed through binding and ATPase activity assays before conducting interaction studies.

How can researchers effectively design knockout and complementation studies to validate IrtB function?

Knockout and complementation studies provide powerful approaches to validate IrtB function in vivo. The research on the IrtA homologue in M. smegmatis (msmeg_6554) demonstrates the utility of this approach .

Methodological workflow:

  • Knockout generation:

    • Allelic exchange methods using suicide vectors

    • CRISPR-Cas9 systems adapted for mycobacteria

    • Confirmation of gene deletion by PCR and sequencing

  • Phenotypic characterization:

    • Growth curves under iron-limited conditions

    • Siderophore export/import quantification

    • Intracellular iron measurements

  • Complementation:

    • Wild-type gene reintroduction

    • Site-directed mutants to assess functional domains

    • Cross-species complementation (e.g., M.tb IrtB in M. smegmatis knockout)

Research has demonstrated that knockout of msmeg_6554 (IrtA homologue) in M. smegmatis results in impaired M.tb siderophore export that can be restored through complementation . Similar approaches can be applied to study IrtB function in iron import, with careful attention to creating complete knockouts without polar effects on adjacent genes.

How should researchers address discrepancies between in vitro and in vivo IrtB functional data?

When investigating membrane transporters like IrtB, researchers often encounter discrepancies between in vitro biochemical data and in vivo functional studies. These differences may arise from:

  • Membrane environment differences:

    • Artificial liposomes vs. complex mycobacterial cell envelope

    • Lipid composition affecting protein conformation and function

  • Protein interaction networks:

    • In vivo systems contain complete protein complexes and interaction partners

    • In vitro systems may lack important accessory proteins

  • Physiological regulation:

    • Iron-dependent regulation mechanisms present in vivo but absent in vitro

    • Post-translational modifications affecting function

Methodological approaches to reconcile discrepancies:

  • Validate in vitro findings using multiple complementary techniques

  • Design in vivo experiments that specifically address the molecular mechanism observed in vitro

  • Utilize conditional expression systems to control protein levels in vivo

  • Consider the temporal aspects of transporter function and regulation

The research on IrtB demonstrates that in vitro liposome reconstitution experiments can validate the two-component IrtB-Rv2895c system as an importer of ferrated siderophores , but these findings should be complemented with cellular studies to confirm physiological relevance.

What statistical approaches are most appropriate for analyzing IrtB experimental data?

The choice of statistical approach depends on the experimental design. For single-subject experimental designs like ABAB:

  • Visual analysis:

    • Trend analysis across experimental phases

    • Level changes between phases

    • Latency of effects after phase changes

  • Statistical methods:

    • Celeration line approach

    • Two-standard deviation band method

    • Percentage of non-overlapping data points

For larger-scale experiments with multiple subjects or conditions:

  • Parametric tests:

    • ANOVA for comparing multiple conditions

    • t-tests for paired comparisons

    • Regression analysis for continuous variables

  • Non-parametric alternatives:

    • Mann-Whitney or Wilcoxon tests for non-normally distributed data

    • Kruskal-Wallis test as non-parametric alternative to ANOVA

The ABAB design offers the advantage of providing multiple measurements using fewer subjects than randomized controlled trials, making it cost-effective for initial investigations before proceeding to larger-scale studies .

How does the substrate specificity of IrtB compare with other mycobacterial ABC transporters?

IrtB demonstrates selectivity for ferrated siderophores when paired with Rv2895c, distinguishing it from other mycobacterial ABC transporters. This specificity is mediated through:

  • The selective binding of Rv2895c to ferrated siderophores

  • The specific interaction between the permease domain of IrtB and Rv2895c

  • The coordination of ATP hydrolysis with substrate translocation

In contrast to IrtB, its paralog IrtA contains an N-terminal substrate binding domain that selectively binds to non-ferrated siderophores, functioning as a siderophore exporter rather than an importer . This functional dichotomy within structurally similar proteins highlights the evolutionary adaptation of ABC transporters for specialized roles in iron homeostasis.

Methodologically, substrate specificity can be investigated through:

  • Competitive binding assays with different siderophores

  • Transport assays using radiolabeled or fluorescently tagged substrates

  • Structural studies of the binding pockets involved in substrate recognition

The experimental data demonstrates that while Rv2895c exhibits higher affinity for ferrated siderophores, the substrate binding domain of IrtA selectively binds to non-ferrated siderophores, illustrating the complementary roles these proteins play in mycobacterial iron acquisition .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.