Recombinant Isochrysis galbana Photosystem I reaction center subunit XI (psaL)

Shipped with Ice Packs
In Stock

Description

Introduction

The Photosystem I (PSI) reaction center subunit XI (psaL) is a critical component of Photosystem I (PSI), a vital protein complex involved in oxygenic photosynthesis . PSI is responsible for using light energy to mediate electron transfer across the thylakoid membrane, ultimately leading to the reduction of NADP+ to NADPH . Isochrysis galbana, a haptophyte alga, is ecologically significant in marine ecosystems and is known for its unique photosynthetic apparatus . Recombinant psaL refers to the protein produced using genetic engineering techniques, allowing for detailed study and manipulation of its properties .

Structure and Function of psaL

The PSI core from Isochrysis galbana comprises 12 subunits, differing from other algae by losing the PsaO subunit and incorporating the PsaK subunit, which is absent in diatoms and dinoflagellates . The psaL subunit is essential for the assembly and stability of the PSI complex .

Key Features of psaL:

  • Protein Names: Photosystem I reaction center subunit XI, PSI subunit V, PSI-L

  • Gene Name: psaL

  • Species: Isochrysis galbana (Marine planktonic alga)

  • Amino Acid Sequence: MSEFVKPFNNDPFVGNLSTPVTTSTATKLYLGNLPIYRKGLTPLLRGLEIGMAHGYFLIGPFYILGPLRNSPNALLVGLFSAFGLIIILTLALTIYGLASFQDNGVGENLESSKGWRNFTSGFTIGALGGASVAYLVLNNISFFA

  • Expression Region: 1-145 amino acids

Role in Photosystem I Assembly and Energy Transfer

PsaL plays a crucial role in the assembly and energy transfer mechanisms within the PSI complex . It interacts with other subunits to stabilize the PSI core and facilitate efficient excitation energy transfer .

Isochrysis galbana exhibits a unique light-harvesting complex I (LHCI) organization with 22 fucoxanthin-chlorophyll a/c-binding light-harvesting antenna proteins (iFCPIs) that form a trilayered antenna arrangement . A pigment-binding subunit, L iFP, facilitates interactions and energy transfer between peripheral iFCPIs and the PSI core . The intricate pigment network ensures efficient transfer of excitation energy .

Genetic and Genomic Context

The complete mitochondrial genome of Isochrysis galbana has been sequenced using Illumina and PacBio sequencing technologies, providing a foundation for genetic studies . The genome harbors a unique repeat structure and a specific trans-spliced cox1 gene .

Genomic Features:

  • The I. galbana genome was sequenced using Illumina HiSeq X Ten platform in paired-end (PE) 150 nt mode .

  • Over 8.92 Gbp clean PE data including 59.45 million high-quality reads were generated, representing around 89× genome equivalents .

  • PacBio sequencing obtained ~15.5 Gb data composed of 2,033,745 million reads, i.e., 166 × coverage of the estimated genome size .

The mitochondrial gene synteny analysis reveals multiple gene order rearrangements within the haptophyte lineage .

Functional Studies and Proteomic Analysis

Proteomic analyses of Isochrysis galbana under various conditions, such as nitrogen deprivation, provide insights into the function and regulation of proteins like psaL . Nitrogen deprivation up-regulates several proteins involved in light-harvesting and energy distribution .

Implications for Biotechnology and Genetic Engineering

Genetic research on microalgae has opened avenues for genetic engineering strategies to improve lipid production . Understanding the molecular mechanisms and functions of proteins like psaL can aid in enhancing photosynthetic efficiency and biomass production in microalgae .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psaL; Photosystem I reaction center subunit XI; PSI subunit V; PSI-L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Isochrysis galbana (Marine planktonic alga)
Target Names
psaL
Target Protein Sequence
MSEFVKPFNNDPFVGNLSTPVTTSTATKLYLGNLPIYRKGLTPLLRGLEIGMAHGYFLIG PFYILGPLRNSPNALLVGLFSAFGLIIILTLALTIYGLASFQDNGVGENLESSKGWRNFT SGFTIGALGGASVAYLVLNNISFFA
Uniprot No.

Target Background

Protein Families
PsaL family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psaL subunit in Isochrysis galbana and what is its primary function?

The psaL protein (Photosystem I reaction center subunit XI) in Isochrysis galbana is a critical component of the photosynthetic apparatus, specifically functioning within Photosystem I (PSI). This protein plays an essential role in maintaining the structural organization of PSI by facilitating the arrangement of PSI trimers, which is crucial for optimal light harvesting and energy transfer during photosynthesis. The protein is encoded by the psaL gene and is also known as PSI subunit V or PSI-L . In I. galbana, this protein is particularly important for adaptation to marine environments and varying light conditions.

How does I. galbana psaL differ from similar subunits in other photosynthetic organisms?

The psaL subunit from I. galbana shows distinct evolutionary adaptations compared to similar proteins in other photosynthetic organisms. While maintaining conserved functional domains, the I. galbana psaL exhibits unique sequence modifications that likely reflect adaptation to marine environments. Phylogenetic analysis of haptophyte mitogenomes places I. galbana as a sister to Emiliania huxleyi and Chrysochromulina tobinii, with an estimated divergence time between I. galbana and E. huxleyi of approximately 133 million years ago .

Comparative genomic analysis reveals that unlike green algae or land plants, the photosystem components of I. galbana have evolved to optimize light harvesting under marine conditions, particularly in the blue-green spectrum of light that penetrates seawater . This is reflected in specific amino acid substitutions within the psaL sequence that may influence protein-pigment interactions and energy transfer efficiency.

What are the optimal conditions for expression of recombinant I. galbana psaL protein?

For optimal expression of recombinant I. galbana psaL, a comprehensive approach is recommended:

  • Expression System Selection: While bacterial expression systems (particularly E. coli BL21(DE3)) provide high yields, eukaryotic systems such as Pichia pastoris may offer better protein folding for this membrane protein.

  • Expression Vector Construction: For bacterial expression, pET-series vectors with a T7 promoter system are effective. Include a His-tag or other affinity tag for purification, preferably at the C-terminus to minimize interference with protein folding.

  • Culture Conditions:

    • Temperature: 18-20°C after induction (lower temperatures reduce inclusion body formation)

    • Induction: 0.1-0.5 mM IPTG for bacterial systems

    • Culture duration: 16-20 hours post-induction

    • Media: Supplemented with appropriate antibiotics and possibly membrane protein expression enhancers

  • Optimization Parameters: Expression yields can be significantly improved by adjusting:

    • Codon optimization for the host organism

    • Induction timing (optimal OD₆₀₀ typically 0.6-0.8)

    • Addition of membrane-mimicking environments for proper folding

For this membrane protein, inclusion of detergents (0.5-1% n-dodecyl β-D-maltoside) during cell lysis and purification is critical to maintain protein solubility and native structure .

What methods are most effective for purification and characterization of recombinant psaL protein?

Effective purification and characterization of recombinant I. galbana psaL requires a specialized approach:

Purification Protocol:

  • Cell Lysis: Use gentle methods (e.g., osmotic shock or enzymatic lysis) with protease inhibitors and appropriate detergent (typically 1% n-dodecyl β-D-maltoside).

  • Initial Purification: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged protein.

  • Secondary Purification: Size exclusion chromatography to separate aggregates and obtain homogenous protein.

  • Buffer Optimization: Maintain 0.05-0.1% detergent in all buffers to prevent protein aggregation.

Characterization Methods:

  • Structural Analysis:

    • Circular Dichroism (CD) spectroscopy to confirm secondary structure

    • Limited proteolysis combined with mass spectrometry for domain mapping

    • Crystallization trials for X-ray diffraction studies (challenging for membrane proteins)

  • Functional Analysis:

    • Reconstitution into liposomes or nanodiscs for functional studies

    • Electron transfer measurements using artificial electron donors/acceptors

    • Binding studies with other PSI subunits

  • Spectroscopic Analysis:

    • Absorption spectroscopy (250-700 nm range)

    • Fluorescence spectroscopy for protein-pigment interactions

    • EPR spectroscopy for redox properties

Each characterization method should be optimized specifically for this membrane protein, with particular attention to maintaining the native environment of the protein during analysis .

How can researchers effectively integrate recombinant psaL into functional photosynthetic complexes for in vitro studies?

Integration of recombinant I. galbana psaL into functional photosynthetic complexes requires a methodical approach:

Reconstitution Methodology:

  • Preparation of Host Complexes:

    • Isolate PSI complexes lacking psaL from model organisms or I. galbana

    • Verify complex integrity using absorption spectroscopy and SDS-PAGE

  • Reconstitution Process:

    • Mix purified recombinant psaL with PSI complexes at 1:1 to 1:3 molar ratios

    • Incubate in reconstitution buffer (typically 50 mM Tris-HCl pH 7.5, 10 mM MgCl₂, 0.05% detergent)

    • Use a gradual detergent dilution method to facilitate incorporation

  • Verification Methods:

    • Blue native PAGE to confirm complex assembly

    • Immunoblotting using anti-psaL antibodies

    • Electron microscopy to visualize complex architecture

    • Functional assays measuring electron transfer rates

  • Alternative Approaches:

    • Co-expression of multiple PSI subunits in heterologous systems

    • Cell-free protein synthesis in the presence of artificial membranes

For more physiologically relevant studies, reconstitution into nanodiscs or liposomes composed of thylakoid-mimicking lipids (e.g., MGDG, DGDG at ratios similar to native thylakoid membranes) has proven particularly effective for maintaining protein function and stability .

How does the psaL subunit contribute to photoadaptation in I. galbana under different light conditions?

The psaL subunit plays a critical role in photoadaptation mechanisms of I. galbana, particularly in response to varying light conditions:

Key Adaptation Mechanisms:

  • Structural Reorganization: Under low light conditions, psaL facilitates the formation of PSI trimers and larger supercomplexes, increasing the cross-section for light harvesting. Under high light conditions, monomerization may occur as a photoprotective mechanism.

  • Interactions with Light-Harvesting Complexes: Experimental evidence suggests that psaL mediates interactions between the PSI core and specific fucoxanthin-chlorophyll binding proteins (FCPs) unique to haptophytes like I. galbana.

  • Light Quality Adaptations: Transcriptome and metabolome analyses reveal that under different light qualities (particularly green light vs. white light), expression of genes related to photosystem assembly, including psaL, is differentially regulated .

Research Findings:
Studies of I. galbana grown under different light intensities (25-200 μmol photons m⁻² s⁻²) demonstrate that optimal growth occurs at 100 μmol photons m⁻² s⁻², with photoperiod significantly affecting growth (optimal at 12h light:12h dark cycles) . The role of psaL in these adaptations appears to involve modulation of PSI oligomerization state and energy distribution between photosystems.

Additionally, experiments using salicylic acid at concentrations of 2.8 × 10⁻⁷ mol·L⁻¹ have shown a stimulating effect on I. galbana growth dynamics, potentially through interaction with photosynthetic apparatus components including psaL, improving photosynthetic efficiency under stress conditions .

What role does the psaL protein play in the interaction between I. galbana and its bacterial symbionts?

Research has revealed fascinating insights into the role of psaL in mediating interactions between I. galbana and bacterial partners:

Symbiotic Interactions:
Transcriptomic analyses of I. galbana co-cultured with the marine heterotrophic bacterium Alteromonas macleodii demonstrated significant upregulation of photosynthesis-related genes, including those encoding PSI components like psaL . The presence of A. macleodii enhanced the growth of I. galbana and inhibited non-photochemical quenching (NPQ) and superoxide dismutase (SOD) activities.

Molecular Mechanisms:

  • Altered Gene Expression: Co-culture experiments show that I. galbana transcriptomes change significantly when grown with bacterial partners, with notable increases in transcripts related to photosynthesis, carbon fixation, and biosynthetic enzymes.

  • Reactive Oxygen Species (ROS) Management: The presence of bacterial symbionts appears to reduce oxidative stress in I. galbana, potentially affecting the redox state of PSI and its components including psaL.

  • Nutrient Exchange: Bacterial partners may provide vitamins or other growth factors that influence the expression and assembly of photosynthetic complexes.

These interactions suggest that the functionality of psaL and the entire PSI complex may be modulated by symbiotic relationships, representing an important ecological adaptation in marine environments. The research indicates that optimizing these interactions could be valuable for improving algal cultivation for biotechnological applications .

How can structural modifications of the psaL protein enhance photosynthetic efficiency in engineered systems?

Engineering the psaL protein presents opportunities for enhancing photosynthetic efficiency in biotechnological applications:

Strategic Modification Approaches:

  • Interface Engineering: Modifying amino acids at protein-protein interfaces can alter PSI oligomerization states. Specifically:

    • Mutations in the N-terminal region (residues 15-40) that influence trimer formation

    • Modifications of hydrophobic residues in transmembrane regions that impact stability

    • Introduction of salt bridges to strengthen interactions with adjacent subunits

  • Pigment-Binding Enhancement: Introducing additional chlorophyll or carotenoid binding sites through targeted mutations could improve light harvesting. Key modifications include:

    • Introducing histidine residues at strategic positions for chlorophyll coordination

    • Engineering carotenoid-binding pockets to enhance photoprotection and light harvesting range

  • Electron Transfer Optimization: Modifications of residues near electron transfer cofactors can potentially improve electron transport kinetics:

    • Altering the protein environment around iron-sulfur clusters

    • Modifying residues involved in proton-coupled electron transfer

Experimental Validation Approaches:
Research suggests combining site-directed mutagenesis with in vitro reconstruction of PSI complexes, followed by functional characterization through:

  • Time-resolved spectroscopy to assess electron transfer rates

  • Quantum yield measurements to quantify photosynthetic efficiency

  • Thermal stability assays to evaluate complex durability

What are the major challenges in expressing functional psaL protein and how can they be overcome?

Researchers face several significant challenges when expressing functional I. galbana psaL protein:

Challenge 1: Membrane Protein Solubility

  • Problem: As a membrane protein, psaL tends to aggregate and form inclusion bodies during expression.

  • Solution: Implement a specialized expression protocol:

    • Use mild induction conditions (lower IPTG concentration, 0.1-0.2 mM)

    • Express at reduced temperatures (16-18°C)

    • Include membrane-mimicking environments during expression

    • Consider fusion tags that enhance solubility (SUMO, MBP, or Mistic tags)

Challenge 2: Proper Folding and Stability

  • Problem: Achieving native conformation in heterologous expression systems.

  • Solution:

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Use specialized E. coli strains (C41(DE3), C43(DE3)) designed for membrane proteins

    • Include stabilizing ligands or cofactors in the growth medium

    • Consider cell-free protein synthesis systems with supplied detergents or lipids

Challenge 3: Low Yield

  • Problem: Typically low expression levels compared to soluble proteins.

  • Solution:

    • Optimize codon usage for the expression host

    • Use strong, tightly regulated promoters

    • Scale up cultivation volume with fed-batch strategies

    • Consider expression in photosynthetic hosts like Chlamydomonas or cyanobacteria

Challenge 4: Protein Verification

  • Problem: Confirming proper folding and functionality is difficult for membrane proteins.

  • Solution:

    • Implement rigorous quality control using CD spectroscopy

    • Evaluate pigment binding through absorption spectroscopy

    • Use native PAGE under mild conditions to assess oligomeric state

    • Develop functional assays specific to psaL's role in PSI assembly

Researchers have had success combining these approaches, particularly when expressing the protein with its native cofactors or in lipid nanodiscs that provide a membrane-like environment .

How can researchers effectively analyze the interaction of psaL with other photosystem I subunits?

Analyzing interactions between psaL and other photosystem I subunits requires specialized techniques:

Methodological Approaches:

  • Co-immunoprecipitation Studies:

    • Develop specific antibodies against I. galbana psaL

    • Perform reciprocal pull-down assays with other PSI subunits

    • Analyze by western blotting and mass spectrometry

    • Quantify interaction strength under various conditions

  • Cross-linking Mass Spectrometry:

    • Apply membrane-permeable crosslinkers (DSS, BS3, or EDC/NHS)

    • Digest crosslinked complexes with specific proteases

    • Analyze crosslinked peptides by LC-MS/MS

    • Identify interaction interfaces through data analysis algorithms

  • FRET Analysis:

    • Generate fusion constructs with appropriate fluorescent proteins

    • Measure energy transfer efficiency between psaL and partner proteins

    • Calculate interaction distances and dynamics

    • Validate in vivo using confocal microscopy

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified psaL on sensor chips containing lipid bilayers

    • Measure binding kinetics with other purified PSI subunits

    • Determine association/dissociation constants

    • Assess effects of environmental factors on binding

  • Isothermal Titration Calorimetry (ITC):

    • Measure thermodynamic parameters of binding

    • Determine stoichiometry of interactions

    • Assess enthalpy and entropy contributions

    • Evaluate effects of mutations on binding energetics

These techniques can be complemented by computational approaches like molecular modeling and docking to predict interaction interfaces and guide experimental design .

What advanced analytical techniques are most informative for studying the structure-function relationship of the psaL protein?

Understanding the structure-function relationship of I. galbana psaL requires integrating multiple advanced analytical techniques:

Structural Analysis Techniques:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Particularly valuable for membrane protein complexes

    • Can resolve PSI structures to near-atomic resolution (3-4 Å)

    • Allows visualization of psaL within the native complex

    • Enables identification of specific interactions with pigments and other subunits

  • Solid-State NMR Spectroscopy:

    • Can analyze membrane proteins in lipid environments

    • Provides information on dynamic regions and conformational changes

    • Identifies specific amino acid interactions at atomic resolution

    • Requires isotopic labeling (¹³C, ¹⁵N) of recombinant protein

  • X-ray Crystallography:

    • Challenging but potentially highest resolution (if crystals can be obtained)

    • Requires optimization of crystallization conditions for membrane proteins

    • May need lipidic cubic phase or bicelle crystallization methods

    • Provides detailed electron density maps for structure determination

Functional Analysis Techniques:

  • Time-Resolved Absorption and Fluorescence Spectroscopy:

    • Measures energy transfer and electron transport kinetics

    • Can detect changes in photochemistry with picosecond resolution

    • Enables correlation of structural features with function

    • Particularly useful for assessing effects of site-directed mutations

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Characterizes electronic structure of paramagnetic centers

    • Provides information on the local environment of redox cofactors

    • Can measure distances between specifically labeled sites

    • Helps understand how psaL influences electron transfer pathways

  • Molecular Dynamics Simulations:

    • Models protein behavior in membrane environments

    • Predicts conformational changes and dynamic interactions

    • Identifies water molecules and ions important for function

    • Guides interpretation of experimental results

The most comprehensive understanding comes from integrating data from multiple techniques, correlating structural features with functional outcomes through targeted mutagenesis studies .

How might genetic modification of the psaL gene enhance biofuel production in I. galbana?

Genetic engineering of the psaL gene presents promising opportunities for enhancing biofuel production in I. galbana:

Strategic Approaches:

  • Optimizing Light Harvesting Efficiency:

    • Targeted modifications to enhance PSI trimer stability could improve light capture under low-light conditions

    • Engineering the psaL protein to alter the balance between PSI and PSII can redirect electron flow toward hydrogen production or lipid synthesis

    • Potential for 15-25% increases in photosynthetic efficiency based on similar modifications in cyanobacteria

  • Stress Response Modulation:

    • Modifications that alter the interaction between psaL and stress-response proteins could enhance growth under production conditions

    • Engineering psaL variants that maintain photosynthetic efficiency under nutrient limitation could increase lipid accumulation

    • Data suggests potential for maintaining photosynthetic activity during nitrogen starvation, when lipid accumulation is highest

  • Enhanced Carbon Partitioning:

    • Modifications that alter the redox state of the photosynthetic electron transport chain can increase carbon flux toward biofuel precursors

    • Targeted psaL variants that modify cyclic electron flow around PSI could enhance ATP production for lipid synthesis

    • Research in other algae suggests potential increases in lipid content of 30-40% through such approaches

Implementation Considerations:
For I. galbana specifically, genetic transformation protocols are still being optimized. Research indicates that electroporation methods with field strengths of 1000-1500 V/cm show promise for transformation efficiency. Selection markers based on zeocin or hygromycin resistance have shown effectiveness in this species. CRISPR-Cas9 approaches may offer the most precise method for psaL gene editing .

What insights can comparative analysis of psaL across different algal species provide for evolutionary photosynthesis research?

Comparative analysis of psaL across algal lineages offers profound insights into photosynthetic evolution:

Evolutionary Insights:

  • Adaptation to Diverse Light Environments:

    • Sequence analysis reveals distinct adaptations in marine haptophytes like I. galbana compared to freshwater and terrestrial species

    • Evidence suggests that psaL has undergone positive selection in lineages adapting to specific spectral light qualities

    • Amino acid substitutions in the pigment-binding regions correlate with habitat light conditions

  • Structural Conservation vs. Functional Divergence:

    • Core structural elements of psaL are highly conserved across 2 billion years of photosynthetic evolution

    • Interface regions mediating interaction with other PSI subunits show lineage-specific adaptations

    • The N-terminal domain exhibits the highest variability, reflecting diverse strategies for PSI oligomerization

  • Horizontal Gene Transfer Contributions:

    • Phylogenetic analysis suggests potential horizontal gene transfer events involving photosystem components

    • The divergence between I. galbana and Emiliania huxleyi occurred approximately 133 million years ago, providing a timeline for haptophyte PSI evolution

Research Applications:
These evolutionary insights enable "phylogenetic engineering" approaches, where beneficial adaptations from different lineages can be combined. Conservation analysis identified 15 core energy and metabolism genes present in haptophyte mitochondrial genomes, including key components of the respiratory electron transport chain. This conservation pattern provides context for understanding the co-evolution of mitochondrial and chloroplast electron transport systems .

The phylogenetic tree constructed by cox1 genes from 204 algal mitochondrial genomes has yielded well-resolved internal relationships, providing new evidence for evolutionary relationships among algal lineages with photosynthetic apparatus of red algal secondary endosymbiotic origin .

How can understanding the interaction between bacterial communities and I. galbana psaL function lead to improved cultivation strategies?

Research into bacterial-algal interactions offers innovative approaches to cultivation optimization:

Bacterial Influence on Photosynthetic Efficiency:

  • Specific Bacterial Partner Selection:

    • Transcriptomic studies reveal that Alteromonas macleodii enhances photosynthesis-related gene expression in I. galbana, including genes encoding PSI components

    • Co-culture experiments show 1.2-fold higher specific growth rates for I. galbana when grown with optimal bacterial partners

    • Bacterial presence inhibits non-photochemical quenching (NPQ) and superoxide dismutase (SOD) activities, suggesting reduced photoxidative stress

  • Mechanistic Understanding:

    • Bacteria may provide vitamins, growth factors, or signaling molecules that influence photosystem assembly

    • Bacterial siderophores may improve iron availability, critical for PSI function

    • Oxygen consumption by bacteria may create microaerobic zones that optimize PSI-mediated cyclic electron flow

  • Practical Applications:

    • Defined bacterial consortia can be developed as "probiotics" for I. galbana cultivation

    • Bacterial metabolites could be identified and supplemented in axenic cultures

    • Ratio optimization of bacteria:algae (optimal ratios appear to be 50:1 for certain partners) could maximize productivity

Implementation Strategy:
Research data suggests a cultivation protocol where I. galbana is grown in mixotrophic conditions with:

  • Addition of selected bacterial strains at specific algae:bacteria ratios

  • Supplementation with 50 mmol glycerol to enhance mixotrophic growth

  • Maintenance at optimal salinity (35‰) and light conditions (100 μmol photons m⁻² s⁻²)

  • 12h:12h light:dark cycle for maximal biomass production

This approach has demonstrated potential yield increases of 25-40% compared to axenic cultures, with additional benefits in culture stability and resistance to contamination .

What are the optimal protocols for studying psaL involvement in non-photochemical quenching mechanisms?

Investigating the role of psaL in non-photochemical quenching (NPQ) requires specialized protocols:

Experimental Design Framework:

  • Pulse Amplitude Modulated (PAM) Fluorometry Protocols:

    • Measure NPQ parameters (qE, qI, qT) in wild-type and psaL-modified samples

    • Standard protocol: dark adaptation (15 min), followed by saturating pulses (0.8 s) during actinic light exposure

    • Compare NPQ kinetics (induction and relaxation) across samples

    • Quantify NPQ components using inhibitors (e.g., nigericin to inhibit qE)

  • Spectroscopic Analysis:

    • Time-resolved fluorescence spectroscopy (picosecond to nanosecond range)

    • Absorption difference spectroscopy to detect carotenoid transitions

    • Circular dichroism measurements to monitor conformational changes

    • Resonance Raman spectroscopy to probe specific pigment environments

  • Biochemical Approaches:

    • Isolation of PSI-LHCI complexes with and without psaL

    • Analysis of xanthophyll cycle pigment composition using HPLC

    • Protein crosslinking to identify psaL interactions during NPQ

    • Reconstitution experiments with purified components

Research Findings:
Studies with I. galbana show that bacterial partners like Alteromonas macleodii significantly inhibit NPQ activities, suggesting that psaL-mediated processes may be modulated by bacterial interaction . The growth of I. galbana is significantly affected by photoperiod, with maximal dry weight obtained at 12h light:12h dark cycles, indicating important diurnal regulation of photosynthetic efficiency and NPQ mechanisms .

Analysis of NPQ in I. galbana should be conducted with awareness of its unique pigment composition, particularly the presence of fucoxanthin as a major carotenoid (6.10 mg per g dry weight), which may contribute to species-specific NPQ mechanisms .

How can researchers effectively study the interaction between psaL and fucoxanthin in I. galbana?

Studying the interaction between psaL and fucoxanthin requires specialized approaches tailored to this unique photosynthetic system:

Methodological Framework:

  • Pigment-Protein Complex Isolation:

    • Develop a gentle isolation protocol using sucrose gradient ultracentrifugation

    • Use detergents optimized for haptophyte membrane proteins (digitonin 1% or n-dodecyl β-D-maltoside 0.5-1%)

    • Implement rapid isolation at low temperature (4°C) to preserve native interactions

    • Verify complex integrity using absorption spectroscopy and native-PAGE

  • Spectroscopic Characterization:

    • Steady-state and time-resolved fluorescence to measure energy transfer

    • Circular dichroism to probe fucoxanthin binding environments

    • Transient absorption spectroscopy to track energy flow from fucoxanthin to chlorophyll

    • Low-temperature (77K) fluorescence to resolve emission bands

  • Structural Analysis:

    • Cryo-EM of isolated complexes to visualize fucoxanthin molecules

    • Mass spectrometry of crosslinked samples to identify interaction sites

    • Molecular docking simulations to predict binding pockets

    • Site-directed mutagenesis of putative fucoxanthin binding residues

  • Functional Assessment:

    • Measure the effect of fucoxanthin content on PSI activity

    • Compare electron transfer rates in complexes with varying fucoxanthin content

    • Assess photostability under high light with modified fucoxanthin binding

    • Quantify reactive oxygen species production

Research Context:
I. galbana contains high fucoxanthin content (6.10 mg per g dry weight), which contributes to its adaptation to marine light environments . Under green light conditions, I. galbana shows increased carotenoid content compared to white light growth , suggesting light-quality dependent regulation of pigment-protein interactions that likely involve psaL as a core PSI subunit.

Multi-omics analyses have identified genes involved in fucoxanthin biosynthesis in I. galbana, providing potential targets for genetic manipulation to study the functional interaction with photosystem components .

What approaches can best elucidate the role of psaL in cyclic electron flow under different environmental conditions?

Investigating the role of psaL in cyclic electron flow (CEF) under varying environmental conditions requires integrated experimental approaches:

Comprehensive Investigation Strategy:

  • In vivo Electron Flow Measurements:

    • P700 redox kinetics using absorbance changes at 820 nm

    • PAM fluorometry with dual wavelength excitation to distinguish PSI and PSII activity

    • Simultaneous gas exchange and chlorophyll fluorescence measurements

    • Electrochromic shift (ECS) measurements to quantify proton motive force generation

  • Comparative Analysis Under Environmental Stressors:

    • Light intensity gradients (25-200 μmol photons m⁻² s⁻²)

    • Salinity stress (test range: 10-65‰, optimal at 35‰)

    • Nutrient limitation (particularly iron, which affects PSI assembly)

    • Temperature variation (optimal range for I. galbana: 15-25°C)

  • Genetic and Biochemical Approaches:

    • Generate psaL variants with altered interaction domains

    • Measure interaction strength with CEF components (NDH-1 or PGR5/PGRL1)

    • Isolate supercomplexes containing both PSI and CEF components

    • Reconstitute CEF activity in liposomes with defined composition

  • Real-time Metabolic Analysis:

    • Measure ATP/NADPH ratios under varying conditions

    • Track carbon flow using ¹³C-labeling and metabolomics

    • Quantify photosynthetic control by monitoring P700 oxidation

    • Assess membrane energization using fluorescent probes

Research Context:
Studies show that I. galbana growth is enhanced in mixotrophy compared to phototrophy, with optimal production occurring at 50 mmol glycerol concentration . This suggests a complex interplay between photosynthetic electron flow and respiratory pathways that likely involves regulation of CEF.

The highest algal growth rate occurs at 100 μmol photons m⁻² s⁻², with significant effects of photoperiod on growth . These observations indicate that light conditions strongly influence electron flow pathways, including CEF, which may involve regulatory functions of the psaL protein in optimizing energy distribution between linear and cyclic pathways under changing environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.