Recombinant Jannaschia sp. ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF1; Jann_0770; ATP synthase subunit b 1; ATP synthase F(0 sector subunit b 1; ATPase subunit I 1; F-type ATPase subunit b 1; F-ATPase subunit b 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Jannaschia sp. (strain CCS1)
Target Names
atpF1
Target Protein Sequence
MRYLTALFVLVASPALAAGDDAPKGLFNPSLGNTDFVVLLGFLLFLAILFYFGVPKMLGG MLDARAEGIRSELDEARALREEAQTLLASYERKAREVEEQSARIVTEARANAETAAEQAK ADIERSITRRLAAAEDQIASAEAKASRAVRDTAASVAVAAAAEVIAGGTSATDQNKMIDE AIEEVGRQLH
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core, and the F0 domain, housing the membrane proton channel. These domains are linked by a central and a peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.

This protein is a component of the F0 channel, forming part of the peripheral stalk that connects F1 and F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • How is recombinant Jannaschia sp. ATP synthase subunit b (atpF) typically expressed and purified for research applications?

    The methodological approach for expression and purification typically involves:

    1. Expression system: E. coli is the preferred expression system due to its high yield and compatibility with the protein .

    2. Construct design: The full-length protein (amino acids 1-190) is typically fused to an N-terminal His-tag to facilitate purification .

    3. Purification protocol:

      • Bacterial cell lysis using sonication or mechanical disruption

      • Immobilized metal affinity chromatography (IMAC) using the His-tag

      • Size exclusion chromatography for further purification

      • SDS-PAGE verification showing an observed molecular weight of approximately 20-22 kDa

    4. Storage: The purified protein is generally lyophilized or stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0. For long-term storage, addition of 5-50% glycerol and storage at -20°C/-80°C is recommended .

  • What experimental approaches are available for studying the function of ATP synthase components in alpha-proteobacteria?

    Several experimental approaches have proven effective:

    1. ATPase activity assays: The coupled ATPase assay is commonly used to measure ATP hydrolysis activity. This spectrophotometric method links ATP hydrolysis to NADH oxidation, allowing continuous monitoring .

    2. Reconstitution experiments: Purified components can be reconstituted into membrane systems (such as chromatophores) to study their function in a membrane environment .

    3. Structural analysis:

      • NMR spectroscopy for solution structure determination

      • X-ray crystallography for high-resolution structures

      • Cryo-electron microscopy for larger complexes

    4. Binding studies: Isothermal titration calorimetry (ITC) can be used to characterize binding parameters of various components, such as the interaction between the ζ subunit and ATP .

Advanced Research Questions

  • How does the ζ subunit regulate ATP synthase activity in alpha-proteobacteria like Jannaschia sp., and what experimental approaches can verify this regulation?

    The ζ subunit acts as a potent inhibitor of F₁F₀-ATPase in free-living alpha-proteobacteria, with unique structural and functional characteristics:

    Regulatory mechanism:

    • The ζ subunit possesses a four-helix bundle structure distinct from other known F₁F₀-ATPase inhibitors

    • It contains a conserved ADP/ATP-binding site that mediates long-range conformational changes

    • ATP binding affects the flexibility of helices α1', α1, and α4, suggesting these regions interact with the F₁F₀-ATPase central stalk

    Experimental verification protocol:

    1. Heterologous reconstitution assay:

      • Purify recombinant ζ subunit (His-tagged for easier purification)

      • Solubilize F₁F₀-ATPase complexes from membrane preparations

      • Preincubate the F₁F₀-ATPase with increasing concentrations of recombinant ζ

      • Measure ATPase activity using the coupled ATPase assay

      • Plot inhibition curves and determine apparent IC₅₀ values

    Representative results from related studies:

    ζ subunitTarget F₁F₀-ATPaseApparent IC₅₀
    Pd-ζPdF₁F₀-ATPase0.44-0.55 μM
    Pd-ζRcF₁F₀-ATPase3.76 μM
    Js-ζRcF₁F₀-ATPase1.12 μM
    Cs-ζCsF₁F₀-ATPase9.7 ± 2.7 nM

    These results demonstrate that the ζ subunit functions as an effective inhibitor with nanomolar to micromolar affinities, with higher affinity observed for native pairings compared to heterologous reconstitutions .

  • What strategies can be employed to investigate the evolutionary conservation of ATP synthase regulatory mechanisms across alpha-proteobacteria?

    The evolutionary conservation of ATP synthase regulation can be investigated through a comprehensive multi-pronged approach:

    1. Comparative sequence analysis:

      • Multiple sequence alignment of ζ subunits from diverse alpha-proteobacteria

      • Identification of conserved motifs, particularly around the ADP/ATP binding site

      • Phylogenetic tree construction to map evolutionary relationships

    2. Structure-function correlation:

      • NMR structure determination of ζ subunits from different species

      • Chemical shift mapping to identify conserved functional sites

      • Comparison of conformational changes upon nucleotide binding

    3. Cross-species functional assays:

      • Expression of recombinant ζ subunits from different species

      • Heterologous reconstitution experiments testing inhibitory activity across species

      • Determination of apparent IC₅₀ values for each heterologous combination

    Evidence from previous research indicates that the ζ subunit evolved while preserving its inhibitory function in free-living alpha-proteobacteria exposed to broad environmental changes . For example, the ζ subunit from Jannaschia sp. (Js-ζ) effectively inhibits the ATPase from Paracoccus denitrificans, demonstrating functional conservation despite sequence divergence .

  • How can structural biology approaches be optimized for studying the conformational dynamics of ATP synthase components from Jannaschia sp.?

    Optimizing structural biology approaches for ATP synthase components requires integrating multiple techniques:

    1. Solution NMR spectroscopy optimization:

      • Isotope labeling strategies: Uniform ¹⁵N/¹³C labeling for backbone and side-chain assignments

      • Selective labeling of specific amino acids for targeted studies

      • TROSY-based experiments for larger subunits or complexes

      • Paramagnetic relaxation enhancement (PRE) for studying long-range interactions

    2. Chemical shift perturbation experiments:

      • Titration with ATP/ADP to map binding sites

      • Analysis of chemical shift changes to identify conformational transitions

      • Data collection at multiple concentrations to determine binding constants

    3. Molecular dynamics simulations:

      • All-atom simulations based on experimental structures

      • Analysis of protein flexibility and conformational space

      • Investigation of the effect of nucleotide binding on protein dynamics

    An illustrative approach is demonstrated in the study of ζ-subunits, where 2D [¹⁵N, ¹H]-correlation spectra in the absence and presence of ATP revealed large chemical shifts of residues near the N-terminal end of α1 and in the loop between α2 and α3, identifying the ATP binding site . These spectroscopic signatures can be correlated with functional changes in enzymatic activity.

  • What methodological considerations are important when studying the redox regulation of ATP synthase activity in alpha-proteobacteria?

    Redox regulation studies of ATP synthase require careful attention to these methodological considerations:

    1. Experimental conditions control:

      • Strict anaerobic conditions for oxygen-sensitive components

      • Precise control of redox potential using defined buffer systems

      • Monitoring of environmental parameters (pH, temperature, ionic strength)

    2. Thioredoxin-based regulation analysis:

      • Expression and purification of recombinant thioredoxin (Trx)

      • Identification of Trx-reducible disulfide bonds in ATP synthase components

      • Reconstitution experiments to test the effect of reduced Trx on ATP synthase activity

    3. Measuring the effect of oxidative stress:

      • Controlled oxidant exposure (H₂O₂, diamide, etc.)

      • Activity measurements before and after oxidant treatment

      • Structural analysis of oxidized vs. reduced states

    Research on Trx-based redox regulation in anaerobic organisms provides a useful model. In methanogens, Trx has been shown to influence multiple processes, including energy generation, by reducing oxidized proteins and synchronizing metabolism with reductant availability . Similar mechanisms may be relevant for alpha-proteobacteria like Jannaschia sp., particularly under fluctuating environmental conditions.

  • How can heterologous reconstitution systems be developed to study the functional interplay between different ATP synthase subunits from Jannaschia sp.?

    Developing effective heterologous reconstitution systems involves:

    1. Component preparation:

      • Expression and purification of individual recombinant subunits with appropriate tags

      • Quality control using biophysical techniques (circular dichroism, dynamic light scattering)

      • Verification of proper folding and stability

    2. Reconstitution strategies:

      • Detergent-mediated reconstitution into liposomes or nanodiscs

      • Step-wise assembly of complexes from purified components

      • Creation of hybrid complexes with subunits from different species

    3. Functional analysis:

      • ATP synthesis assays using artificial proton gradients

      • ATP hydrolysis measurements using coupled enzymatic assays

      • Proton pumping assays with pH-sensitive fluorescent dyes

    4. Interaction analysis:

      • Pull-down assays to verify binding between subunits

      • Native gel electrophoresis to assess complex formation

      • Surface plasmon resonance for binding kinetics

    Previous research has successfully employed heterologous reconstitution to study the inhibitory function of ζ subunits across related alpha-proteobacteria. For example, recombinant ζ subunits from Paracoccus denitrificans (Pd-ζ) and Jannaschia sp. (Js-ζ) were reconstituted into the F₁F₀-ATPase of Rhodobacter capsulatus (Rc-F₁F₀) solubilized from chromatophores, demonstrating their ability to bind productively to the Rc-F₁-ATPase binding site .

Research-Grade Protein Specifications

For researchers planning to work with recombinant Jannaschia sp. ATP synthase subunit b (atpF), the following specifications are typically available for research-grade protein:

ParameterSpecification
Amino acid sequenceFull length (1-190aa)
Expression systemE. coli
TagN-terminal His-tag
Purity>90% by SDS-PAGE
Molecular weight~20-22 kDa
FormLyophilized powder
Storage bufferTris/PBS-based, 6% Trehalose, pH 8.0
Recommended storage-20°C/-80°C, with 5-50% glycerol for long-term storage
ApplicationsStructural studies, enzymatic assays, antibody production, protein-protein interaction studies
UniProt IDQ28UC5

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.