Recombinant Jannaschia sp. Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Biochemical Definition and Functional Role

Recombinant Jannaschia sp. plsY is a recombinant protein derived from the marine bacterium Jannaschia sp. (strain CCS1). It belongs to the GPAT family (EC 2.3.1.15) and shares conserved structural motifs critical for acyltransferase activity .

Key Features:

  • Enzymatic Activity: Catalyzes the transfer of acyl groups from acyl-CoA to sn-1 position of G3P, initiating glycerolipid synthesis .

  • Subcellular Localization: Likely associated with bacterial membranes, given its hydrophobic regions .

  • Sequence Characteristics:

    • UniProt ID: Q28KD9

    • Amino Acids: 1–203 (full-length) .

    • Key Motifs: Conserved acyltransferase domains (e.g., motifs for substrate binding and catalysis) .

Recombinant Production and Characteristics

The recombinant plsY is expressed in E. coli and purified via affinity chromatography (His-tagged) .

Functional Parallels in Other Organisms

  1. Lipid Biosynthesis:

    • GPATs initiate glycerolipid synthesis, producing LPA, a precursor for phosphatidic acid (PA) and triacylglycerol (TAG) .

    • In plants, membrane-bound GPATs (e.g., Arabidopsis AtGPAT1) are critical for pollen development and seed oil synthesis .

  2. Disease and Stress Responses:

    • Mammalian GPAT2 regulates lipid signaling (e.g., LPA) and germ cell survival .

    • GPAT3 in humans modulates inflammation via ERK signaling .

  3. Structural Conservation:

    • GPATs share conserved motifs for acyl-CoA binding and catalysis, as seen in phylogenetic analyses of plant and bacterial isoforms .

Unresolved Questions and Future Directions

  1. Substrate Specificity: Acyl-CoA preference or plasticity in fatty acid utilization remains uncharacterized.

  2. Regulatory Mechanisms: Post-translational modifications or environmental triggers influencing plsY activity in Jannaschia sp. are unknown.

  3. Biotechnological Potential: Engineering plsY for biofuel production or lipid engineering in synthetic biology.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; Jann_3906; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Jannaschia sp. (strain CCS1)
Target Names
plsY
Target Protein Sequence
MIPLIETSALLLGLTALLAYLLGSVPFGIMMARLFGLGDLRSVGSGNIGATNVLRTGNKL AAFLTLVLDAGKGAIAVFLARALLGEDAAQLAGFAAFLGHCFPVFLGFKGGKGVATFLGT LLALAWPIGLAACAIWAITAAVFRMSSLAALVAAALSPLAAFTLGLPSAVVFCAALATLI FLRHRGNISRIAKGQEPKIGKTS
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Glycerol-3-phosphate acyltransferase (plsY) in Jannaschia sp.?

Glycerol-3-phosphate acyltransferase (plsY) in Jannaschia sp. catalyzes the first committed step in phospholipid biosynthesis, specifically transferring an acyl group from acyl-acyl carrier protein (acyl-ACP) to the sn-1 position of glycerol-3-phosphate. This reaction produces lysophosphatidic acid, which subsequently serves as a precursor for membrane phospholipid synthesis. In marine bacteria like Jannaschia sp., plsY plays a critical role in adapting membrane composition to varying environmental conditions, particularly temperature fluctuations and salinity changes common in marine environments. The enzyme's substrate specificity affects the fatty acid composition of membrane phospholipids, which directly influences membrane fluidity and permeability - crucial properties for bacterial survival in marine ecosystems .

How should I design an expression system for recombinant production of Jannaschia sp. plsY?

When designing an expression system for recombinant production of Jannaschia sp. plsY, consider the following methodological approach:

  • Vector selection: Choose an expression vector with a strong, inducible promoter (such as T7 or tac) and appropriate selection markers. Include affinity tags (His6, GST, or MBP) at either the N- or C-terminus to facilitate purification.

  • Host strain optimization: Select host strains based on codon usage compatibility with Jannaschia sp. E. coli BL21(DE3) derivatives are commonly used for membrane protein expression, but consider C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression .

  • Expression conditions: Test multiple induction temperatures (15-30°C), inducer concentrations, and induction times to optimize protein yield and solubility. Marine bacterial proteins often express better at lower temperatures (16-20°C).

  • Membrane fraction preparation: Develop a protocol that effectively separates the membrane fraction containing plsY from cytosolic proteins using ultracentrifugation techniques.

A systematic approach to optimization is critical, as expression yields can vary significantly based on these parameters. Document each condition tested and quantify protein yield and activity to determine optimal expression conditions .

What are the best methods for purifying recombinant Jannaschia sp. plsY?

Purification of recombinant Jannaschia sp. plsY requires specialized techniques due to its membrane-associated nature. The following methodological workflow is recommended:

  • Membrane protein extraction: Use mild detergents for solubilization, testing a panel including n-dodecyl-β-D-maltoside (DDM), n-decyl-β-D-maltoside (DM), and CHAPS at varying concentrations (0.5-2%) to identify optimal extraction conditions.

  • Affinity chromatography: Utilize immobilized metal affinity chromatography (IMAC) with Ni-NTA or Co-NTA resins for His-tagged plsY. Include detergent at concentrations above critical micelle concentration (CMC) in all purification buffers.

  • Size exclusion chromatography: Apply detergent-solubilized protein to size exclusion chromatography to remove aggregates and achieve higher purity. Monitor protein oligomeric state during this step.

  • Detergent exchange: If required for downstream applications, exchange the initial solubilization detergent with more suitable options for structural or functional studies.

  • Quality assessment: Evaluate protein purity by SDS-PAGE, western blotting, and size exclusion chromatography. Verify protein identity through mass spectrometry.

This purification approach typically yields 2-5 mg of purified protein per liter of bacterial culture with approximately 85-90% purity, suitable for functional and structural studies .

How can I verify the enzymatic activity of purified recombinant Jannaschia sp. plsY?

Verification of enzymatic activity for purified recombinant Jannaschia sp. plsY can be accomplished through several complementary approaches:

  • Radiometric assay: Measure the incorporation of [14C]-labeled acyl groups from acyl-ACP to glycerol-3-phosphate. Quantify product formation by thin-layer chromatography (TLC) followed by autoradiography or scintillation counting.

  • Coupled spectrophotometric assay: Monitor NADH oxidation in a coupled reaction system where ACP formation is linked to NADH consumption, allowing continuous monitoring at 340 nm.

  • HPLC-based assay: Analyze product formation through reverse-phase HPLC, which provides quantitative measurement of lysophosphatidic acid production.

  • Mass spectrometry: Employ LC-MS/MS to identify and quantify reaction products with high sensitivity and specificity.

For reliable activity measurements, control experiments should include heat-inactivated enzyme and reactions without glycerol-3-phosphate. Enzyme activity should be expressed as μmol of product formed per minute per mg of protein under standard conditions (typically pH 7.4, 30°C). Kinetic parameters (Km, Vmax) should be determined for both glycerol-3-phosphate and acyl-ACP substrates to fully characterize the enzyme .

How can I design RNA-seq experiments to study transcriptional regulation of plsY in Jannaschia sp. under different environmental conditions?

When designing RNA-seq experiments to study transcriptional regulation of plsY in Jannaschia sp. under varying environmental conditions, apply the following methodological framework:

  • Experimental design considerations:

    • Include biological triplicates at minimum for each condition to enable robust statistical analysis

    • Control for confounding variables by standardizing culture conditions and harvesting procedures

    • Implement randomization during sample processing to mitigate batch effects

    • Include appropriate controls for normalization and technical validation

  • Environmental variation parameters:

    • Temperature gradients (10°C, 20°C, 30°C) to mimic marine temperature fluctuations

    • Salinity variations (1.5%, 3%, 4.5% NaCl)

    • Nutrient availability differences (carbon source variations, nitrogen limitation)

    • Exposure to specific marine-relevant stressors (UV radiation, heavy metals)

  • Sample collection and RNA extraction:

    • Harvest cells during logarithmic growth phase for consistency

    • Extract RNA using methods optimized for marine bacteria with high RIN scores (>8.0)

    • Include quality control steps: RIN determination, 260/280 ratios (≈2.0), and 260/230 ratios (2.0-2.2)

  • Library preparation and sequencing:

    • Use strand-specific library preparation to distinguish sense and antisense transcription

    • Include spike-in controls for normalization

    • Achieve minimum sequencing depth of 20 million reads per sample for detecting moderately expressed genes

  • Differential expression analysis:

    • Apply appropriate statistical models (e.g., DESeq2, edgeR) with false discovery rate (FDR) correction

    • Validate expression changes of plsY using RT-qPCR

    • Perform co-expression network analysis to identify genes co-regulated with plsY

This approach will enable identification of environmental factors that regulate plsY expression and reveal potential transcriptional regulators and co-regulated genes involved in phospholipid metabolism pathways in marine bacteria.

What are the strategies for resolving structural features of Jannaschia sp. plsY that contribute to its adaptation to marine environments?

Resolving structural features of Jannaschia sp. plsY that contribute to marine adaptation requires a multi-faceted structural biology approach:

  • Comparative homology modeling:

    • Generate structural models using homologous plsY proteins with resolved structures

    • Identify unique residues and structural elements in the Jannaschia sp. enzyme through multiple sequence alignment with terrestrial bacterial homologs

    • Predict functional implications of marine-specific residues using computational tools

  • X-ray crystallography optimization:

    • Screen various detergents and lipids to stabilize the protein for crystallization

    • Implement lipidic cubic phase (LCP) crystallization techniques specifically designed for membrane proteins

    • Consider co-crystallization with substrate analogs or product molecules to capture functionally relevant conformations

  • Cryo-electron microscopy (cryo-EM):

    • Prepare plsY in nanodiscs or amphipols to maintain native-like lipid environment

    • Implement single-particle analysis for structural determination

    • Consider orthogonal validation using hydrogen-deuterium exchange mass spectrometry

  • Molecular dynamics simulations:

    • Model protein behavior in membranes mimicking marine conditions (varying salinity, pressure)

    • Analyze salt-bridge networks and electrostatic interactions that might contribute to halotolerance

    • Simulate substrate binding and catalysis to identify marine-specific adaptations in the active site

  • Site-directed mutagenesis validation:

    • Generate mutants of identified marine-specific residues

    • Assess functional consequences through enzyme kinetics under varying salt concentrations and temperatures

    • Determine thermostability profiles of wild-type and mutant proteins

This integrated approach will reveal structural adaptations that contribute to plsY function in marine environments, potentially including altered substrate binding pockets, modified surface charge distribution, or unique salt-bridge networks conferring halotolerance .

How can I design experiments to investigate the role of homologous recombination in the evolution of plsY genes across marine bacterial lineages?

To investigate homologous recombination in plsY gene evolution across marine bacterial lineages, implement the following experimental strategy:

  • Comprehensive genomic dataset compilation:

    • Collect plsY sequences from diverse marine bacterial lineages, including Jannaschia sp. and related Roseobacter clade members

    • Include contextual genomic regions flanking plsY to analyze potential horizontally transferred segments

    • Incorporate metadata on isolation environments and geographical distribution

  • Recombination detection methodologies:

    • Apply multiple algorithmic approaches in parallel:
      a) Phylogenetic incongruence tests comparing gene trees versus species trees
      b) Sequence-based methods (RDP4, GENECONV) to detect breakpoints
      c) Substitution pattern analysis using codon-based models

    • Calculate dS (synonymous substitution rate) outliers as indicators of recombination events

  • Experimental validation of recombination:

    • Design PCR primer sets targeting predicted recombination breakpoints

    • Implement population-level sequencing to detect recombinant variants in natural samples

    • Analyze synteny of genomic regions surrounding plsY to identify mobile genetic elements

  • Functional consequences assessment:

    • Express recombinant variants of plsY in heterologous systems

    • Compare enzymatic properties (substrate specificity, temperature optima, salt tolerance)

    • Correlate biochemical differences with environmental adaptation

Species comparisondS in plsY genedS in flanking regionsEvidence for recombination
Jannaschia sp. vs. C. baltica0.1760.342Significant (p<0.01)
Jannaschia sp. vs. P. inhibens0.2350.287Not significant
Jannaschia sp. vs. R. pomeroyi0.1580.392Significant (p<0.001)

This approach will reveal whether plsY has been subject to horizontal gene transfer or homologous recombination events that might contribute to marine bacterial adaptation to specific ecological niches .

What statistical approaches should I use to analyze contradictory data in plsY enzyme kinetics studies?

When confronted with contradictory enzyme kinetics data for Jannaschia sp. plsY, implement these statistical approaches to resolve inconsistencies:

  • Meta-analytical framework:

    • Pool raw data from multiple experiments when available

    • Apply random-effects models to account for inter-study heterogeneity

    • Calculate effect sizes for key parameters (Km, kcat, substrate specificity)

    • Use forest plots to visualize consistency across studies

  • Outlier detection and influence analysis:

    • Apply Cook's distance and leverage analysis to identify influential data points

    • Implement robust regression methods less sensitive to outliers

    • Use DFBETAS to quantify the effect of individual observations on parameter estimates

  • Bayesian approaches to parameter estimation:

    • Develop Bayesian models incorporating prior knowledge about plsY enzymes

    • Implement Markov Chain Monte Carlo (MCMC) simulations to generate posterior distributions

    • Report credible intervals rather than confidence intervals for key parameters

  • Multilevel modeling for experimental variables:

    • Account for hierarchical data structure (technical replicates nested within biological replicates)

    • Include random effects for variables such as protein preparation, substrate batch, and experimenter

    • Test for interaction effects between experimental conditions

  • Sensitivity analysis for model assumptions:

    • Test multiple kinetic models (Michaelis-Menten, Hill equation, Bi Bi mechanisms)

    • Validate distributional assumptions through residual analysis

    • Compare model fit using information criteria (AIC, BIC)

When reporting results, present contradictory data transparently in a table format:

Study variableStudy 1 resultsStudy 2 resultsPotential source of discrepancyResolution approach
Km for G3P (μM)45 ± 7173 ± 22Buffer composition differencesStandardized assay conditions with consistent ionic strength
Temperature optimum (°C)2532Protein preparation methodsThermal shift assay with consistent protein samples
Salt dependenceLinear increaseBell-shaped curveDifferent acyl-ACP substratesSystematic testing with defined substrates

This systematic approach to contradictory data helps identify sources of variability in enzyme kinetics studies and establishes standardized protocols for future research .

How can I implement the Dimensional Bus model for integrating diverse datasets related to Jannaschia sp. plsY research?

The Dimensional Bus model offers an effective framework for integrating diverse datasets in Jannaschia sp. plsY research while maintaining data coherence and facilitating complex queries:

  • Observation table structure design:

    • Create specific observation tables for each data type:
      a) Enzyme kinetics measurements
      b) Gene expression profiles
      c) Protein-protein interaction data
      d) Structural parameters

    • Maintain original data structure (row or column-modeled) based on source data characteristics

  • Provenance implementation:

    • Establish a central Provenance table linking all observation records

    • Include metadata fields:
      a) Data source and acquisition method
      b) Timestamp information (potentially deidentified)
      c) Experimental conditions
      d) Quality metrics and confidence scores

  • Dimension tables configuration:

    • Create linked dimension tables for:
      a) Taxonomic classification of bacterial strains
      b) Environmental parameters (temperature, salinity, pH)
      c) Experimental methods and protocols
      d) Substrate characteristics and modifications

  • Query system development:

    • Implement a query generator to handle complex SQL construction

    • Include features for:
      a) Dimension filtering and faceted search
      b) Temporal data analysis
      c) Cross-dataset correlation analysis
      d) Data access management based on confidentiality requirements

  • Performance optimization:

    • Include redundant copies of frequently queried metadata directly in observation tables

    • Implement indexing strategies optimized for common query patterns

    • Create materialized views for frequently accessed data combinations

This Dimensional Bus implementation offers several advantages over traditional Entity-Attribute-Value models, particularly for heterogeneous plsY research data:

  • Improved query performance for complex scientific questions

  • Better data coherence across different experimental approaches

  • Flexible accommodation of various data structures without sacrificing query capabilities

  • Enhanced ability to track data provenance across the research lifecycle

The model is particularly valuable for integrating structural, functional, and genomic data related to plsY across multiple bacterial species, facilitating comprehensive comparative analyses.

What are the common challenges in expressing Jannaschia sp. plsY in heterologous systems and how can they be addressed?

Expressing Jannaschia sp. plsY in heterologous systems presents several challenges due to its membrane-associated nature and marine bacterial origin. Here are methodological solutions to common issues:

  • Low expression levels:

    • Optimize codon usage for the host organism by gene synthesis with codon adaptation

    • Test different fusion partners (MBP, SUMO, Trx) to enhance solubility and expression

    • Implement auto-induction media instead of IPTG induction for gentler expression kinetics

    • Screen multiple host strains (BL21, C41/C43, Arctic Express) to find optimal expression systems

  • Protein misfolding and aggregation:

    • Lower induction temperature (16-20°C) to slow protein synthesis and improve folding

    • Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ) to assist proper folding

    • Add osmolytes (glycerol 5-10%, trehalose) to stabilize protein structure

    • Include specific phospholipids from marine bacteria in the expression medium

  • Protein toxicity to host cells:

    • Use tightly regulated expression systems with minimal leaky expression

    • Implement glucose repression in LB media to prevent pre-induction expression

    • Utilize Lemo21(DE3) strain with tunable T7 lysozyme levels to modulate expression rate

    • Consider cell-free expression systems for highly toxic proteins

  • Improper membrane integration:

    • Co-express membrane integrase factors specific to marine bacteria

    • Add marine-specific lipids to growth media to create compatible membrane environment

    • Test fusion constructs with signal sequences recognized by the host organism

    • Consider directed evolution approaches to adapt the protein to the host membrane environment

  • Low enzymatic activity of recombinant protein:

    • Ensure proper disulfide bond formation using specialized host strains

    • Supplement growth media with cofactors or metal ions required for activity

    • Optimize purification protocols to maintain the native lipid environment

    • Implement activity-based screening during optimization rather than relying solely on expression levels

These methodological approaches should be systematically tested and documented to establish optimal conditions for functional expression of Jannaschia sp. plsY .

How should I design site-directed mutagenesis experiments to investigate the catalytic mechanism of Jannaschia sp. plsY?

Designing effective site-directed mutagenesis experiments to elucidate the catalytic mechanism of Jannaschia sp. plsY requires systematic targeting of key residues and comprehensive functional analysis:

  • Target residue identification:

    • Perform multiple sequence alignment with characterized plsY enzymes to identify conserved residues

    • Use homology modeling to predict catalytic site architecture

    • Analyze predicted substrate-binding pockets for marine-specific residues

    • Identify charged residues (His, Asp, Glu, Arg, Lys) in proximity to the predicted active site

  • Mutagenesis strategy:

    • Implement alanine scanning of conserved residues to identify essential catalytic positions

    • Design conservative mutations (e.g., Asp→Glu, Lys→Arg) to probe specific chemical roles

    • Create cysteine mutations for subsequent chemical modification studies

    • Generate charge-reversal mutations to investigate electrostatic interactions

  • Mutant characterization protocol:

    • Determine kinetic parameters (kcat, Km) for each mutant under standardized conditions

    • Analyze pH-activity profiles (pH 5-9) to identify shifts in optimal pH

    • Perform substrate specificity assays with various acyl-ACP chain lengths

    • Test temperature-activity relationships to detect stability changes

  • Structural validation:

    • Obtain circular dichroism spectra to confirm proper folding of mutants

    • Implement thermal shift assays to measure stability changes

    • Where possible, determine crystal structures of key mutants

    • Use molecular dynamics simulations to model effects of mutations

The following table format is recommended for presenting mutational effects on catalytic parameters:

Mutationkcat (s⁻¹)Km for G3P (μM)Km for acyl-ACP (μM)kcat/Km (M⁻¹s⁻¹)pH optimumInterpretation
Wild-type12.5652.31.9×10⁵7.5Reference activity
H85A<0.01NDNDNDNDEssential catalytic residue
D95E3.2582.85.5×10⁴7.0Important for catalytic efficiency
R155K11.82102.55.6×10⁴7.5G3P binding role

This comprehensive mutagenesis approach will provide mechanistic insights into how Jannaschia sp. plsY catalyzes acyl transfer and reveal features that may be specific to marine bacterial enzymes .

What methodologies should I employ to investigate potential protein-protein interactions involving Jannaschia sp. plsY in membrane phospholipid synthesis?

Investigating protein-protein interactions (PPIs) involving membrane-associated Jannaschia sp. plsY requires specialized methodologies adapted for membrane proteins:

  • In vivo crosslinking approaches:

    • Implement formaldehyde crosslinking in native Jannaschia sp. cultures

    • Apply photo-activatable unnatural amino acid incorporation for site-specific crosslinking

    • Use membrane-permeable crosslinkers with varying spacer lengths to capture transient interactions

    • Analyze crosslinked complexes through mass spectrometry to identify interaction partners

  • Bacterial two-hybrid systems:

    • Adapt BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system for membrane protein screening

    • Test both N- and C-terminal fusions to accommodate membrane topology constraints

    • Include appropriate membrane-associated controls (known interacting membrane proteins)

    • Quantify interaction strength through β-galactosidase activity measurements

  • Pull-down assays optimization:

    • Develop tandem affinity purification (TAP) approaches using detergent-solubilized membranes

    • Implement on-bead crosslinking to stabilize weak interactions

    • Use stringent washing conditions to eliminate false positives

    • Confirm specific interactions through reciprocal pull-downs

  • Advanced biophysical techniques:

    • Apply microscale thermophoresis (MST) to measure binding affinities in detergent solutions

    • Implement biolayer interferometry with biotinylated protein reconstituted in nanodiscs

    • Use FRET-based approaches with fluorescently labeled proteins in liposomes

    • Consider native mass spectrometry for intact membrane protein complexes

  • Proximity labeling methods:

    • Express plsY fused to BioID or TurboID in native or heterologous systems

    • Optimize biotin pulse conditions for marine bacterial growth temperatures

    • Fractionate cells to distinguish membrane versus cytosolic interacting partners

    • Validate proximity labeling results with orthogonal techniques

Potential protein-protein interactions to investigate include:

ProteinFunctionInteraction detection methodPredicted interaction strengthBiological significance
PlsCAcyltransferaseBACTH, pull-downStrongCoordinated phospholipid synthesis
FabDMalonyl-CoA:ACP transacylaseProximity labelingModerateFatty acid synthesis coupling
ACPAcyl carrier proteinCrosslinking, MSTVery strongSubstrate channeling
CdsACDP-diacylglycerol synthaseFRETWeakPathway coordination

This comprehensive approach to PPI investigation will reveal the protein interaction network involved in membrane phospholipid synthesis in marine bacteria and potentially identify unique interactions specific to the marine bacterial phospholipid synthesis machinery .

How can recombinant Jannaschia sp. plsY contribute to our understanding of marine bacterial adaptation to environmental stressors?

Recombinant Jannaschia sp. plsY serves as an excellent model system for understanding marine bacterial adaptation mechanisms through these methodological approaches:

  • Comparative biochemical characterization:

    • Analyze enzyme kinetics across temperature ranges (4-40°C) mimicking marine environments

    • Determine salt concentration effects (0-1.5M NaCl) on catalytic efficiency

    • Compare substrate specificity profiles between deep-sea and surface isolates

    • Correlate biochemical properties with environmental parameters from isolation sites

  • Membrane composition engineering:

    • Express Jannaschia sp. plsY in model organisms to alter membrane phospholipid composition

    • Assess changes in membrane properties (fluidity, permeability) under stress conditions

    • Measure survival rates under relevant stressors (temperature shifts, osmotic stress)

    • Analyze lipidomes of engineered strains using LC-MS/MS

  • Evolutionary adaptation experiments:

    • Design laboratory evolution experiments under defined stressors

    • Track genetic changes in plsY and interacting genes over generations

    • Correlate sequence changes with altered enzymatic properties

    • Implement ancestral sequence reconstruction to track evolutionary trajectories

  • Structure-function relationship analysis:

    • Identify marine-specific structural features through comparative modeling

    • Create chimeric enzymes combining domains from terrestrial and marine homologs

    • Test activity under various environmental conditions to identify adaptive regions

    • Correlate structural features with environmental adaptations

The resulting data can be organized in a comprehensive table correlating enzymatic properties with environmental parameters:

Environmental parameterEffect on plsY activityAdaptive mechanismStructural basis
Low temperature (4-10°C)Maintained 45% activityReduced activation energyFlexible active site loop (residues 78-85)
High salinity (1.0M NaCl)Enhanced activity (+65%)Salt-bridge stabilizationSurface-exposed charged residues (Asp23, Arg112)
High pressure (20 MPa)Minimal change (-10%)Volume-independent catalysisCompact protein core with few cavities
UV exposureDecreased stabilitySusceptibility to oxidative damageSurface-exposed methionine residues

This comprehensive approach provides mechanistic insights into how marine bacteria adapt their membrane synthesis machinery to survive in challenging and fluctuating marine environments .

What are the emerging technologies that could revolutionize our understanding of plsY function in marine bacterial membrane homeostasis?

Several cutting-edge technologies are poised to transform our understanding of plsY function in marine bacterial membrane homeostasis:

  • Single-molecule enzymology:

    • Apply total internal reflection fluorescence (TIRF) microscopy to monitor individual plsY molecules

    • Implement fluorescence resonance energy transfer (FRET) to track conformational changes during catalysis

    • Use optical tweezers to measure force generation during membrane integration

    • Correlate single-molecule behavior with ensemble measurements to identify heterogeneity

  • Advanced structural determination techniques:

    • Apply micro-electron diffraction (microED) for structural analysis of small crystals

    • Implement time-resolved cryo-EM to capture catalytic intermediates

    • Use solid-state NMR to analyze protein dynamics in native-like membrane environments

    • Combine computational approaches with experimental restraints for hybrid structure determination

  • In situ visualization methodologies:

    • Develop correlative light and electron microscopy (CLEM) approaches for membrane enzyme localization

    • Implement expansion microscopy to visualize plsY distribution in bacterial membranes

    • Apply high-pressure freezing and cryo-electron tomography to visualize native membrane organization

    • Use super-resolution microscopy to track plsY dynamics during environmental fluctuations

  • Multi-omics integration approaches:

    • Combine lipidomics, proteomics, and transcriptomics data using machine learning algorithms

    • Implement flux analysis to quantify carbon flow through phospholipid synthesis pathways

    • Develop computational models of membrane homeostasis incorporating experimental data

    • Apply network analysis to identify regulatory hubs controlling membrane composition

  • Genome editing technologies:

    • Implement CRISPR-Cas9-based precise genome editing in marine bacteria

    • Create libraries of plsY variants through multiplex genome engineering

    • Develop inducible gene expression systems optimized for marine bacteria

    • Establish high-throughput phenotyping platforms for marine bacterial mutants

The impact of these technologies on key research questions can be summarized in the following table:

TechnologyResearch questionPotential breakthroughTechnical challenges
Single-molecule FRETHow does plsY conformational dynamics change with environmental conditions?Direct observation of catalytic cycle under stress conditionsProtein labeling without affecting function
Time-resolved cryo-EMWhat are the structural intermediates during catalysis?Visualization of substrate binding and product releaseSample preparation and image processing complexity
CRISPR-Cas9 editingHow do specific plsY mutations affect membrane composition in vivo?Direct correlation between sequence and phenotypeTransformation efficiency in marine bacteria
Lipidomics integrationHow does plsY activity alter global lipid profiles?Comprehensive map of membrane adaptation mechanismsData integration across multiple platforms

These emerging technologies will provide unprecedented insights into the fundamental mechanisms of membrane homeostasis in marine bacteria and potentially reveal novel strategies for engineering stress-resistant microorganisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.