Recombinant Jannaschia sp. Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Basic Properties

PropertyDetailsSource
UniProt IDQ28US2
Gene NamecrcB
Protein Length1–105 amino acids (varies by construct)
Expression SystemEscherichia coli (N-terminal His-tag)
Molecular Weight~10.8 kDa (estimated)
Amino Acid SequencemLRVFGHGTVGGAFPLPILTVNVLGSFLMGVFVVAAAHRGLTHLSPLVMTGLLGGFTTFS AFSLETVTLYERGDVGQAALYVALSVGLSIAGLMAGLWLARGVFA

Mechanism of Action

The CrcB protein is critical for reducing intracellular fluoride concentrations, mitigating its toxicity. Key findings include:

  • Fluoride Transport: CrcB homologs in E. coli and Pseudomonas syringae act as fluoride exporters, enabling bacterial survival under high fluoride stress .

  • Regulatory Link: crcB genes are often regulated by fluoride riboswitches, which bind fluoride ions to control gene expression .

  • Genetic Validation: crcB knockout strains show impaired growth at 50 mM fluoride, correlating with elevated intracellular fluoride levels .

Riboswitch Association

Riboswitch FeatureRole in crcB RegulationSource
Aptamer DomainBinds fluoride ions with K<sub>D</sub> ~60 μM
Expression PlatformControls transcription/translation initiation in response to fluoride

Notable Research Uses

  • SDS-PAGE: Used to verify protein purity and migration patterns .

  • ELISA: Employed in immunoassays for antibody binding studies .

  • Functional Studies: Assessed for fluoride transport activity in heterologous systems .

Key Studies

  1. Fluoride Resistance Mechanism

    • E. coli strains lacking crcB showed 100% mortality at 50 mM fluoride, while wild-type strains survived .

    • Complementation with Pseudomonas syringae eriC restored fluoride resistance, confirming functional equivalence .

  2. Structural Insights

    • The crcB riboswitch undergoes conformational changes upon fluoride binding, forming an intrinsic transcription terminator .

    • Homologs in Jannaschia sp. CCS1 lack phosphonate transport genes, suggesting alternative phosphorus acquisition strategies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB; Jann_0623; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Jannaschia sp. (strain CCS1)
Target Names
crcB
Target Protein Sequence
MLRVFGHGTVGGAFPLPILTVNVLGSFLMGVFVVAAAHRGLTHLSPLVMTGLLGGFTTFS AFSLETVTLYERGDVGQAALYVALSVGLSIAGLMAGLWLARGVFA
Uniprot No.

Target Background

Function
Plays a crucial role in reducing fluoride concentration within the cell, thereby minimizing its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Jannaschia sp. Protein CrcB homolog (crcB)?

Recombinant Jannaschia sp. Protein CrcB homolog (crcB) is a protein derived from the marine bacterium Jannaschia sp. The recombinant form is produced through genetic engineering techniques to express the protein in a suitable host organism for research purposes. According to chemical database information, this protein is available commercially for research applications with limited published structural information .

What are the fundamental characteristics of the CrcB protein family?

The CrcB protein family consists of membrane proteins that typically function in ion channel and transport activities. These proteins are found across diverse bacterial species and play roles in cellular homeostasis. Specific characteristics of the Jannaschia sp. CrcB homolog are still being investigated through various structural and functional studies. Research on related CrcB homologs provides a foundation for understanding likely functional domains and mechanisms .

What expression systems are most effective for producing Recombinant Jannaschia sp. CrcB homolog?

Based on research with similar marine bacterial proteins, effective expression systems include:

Expression SystemAdvantagesLimitations
E. coli BL21(DE3)High yield, economicalPotential folding issues with membrane proteins
Insect cell systemsBetter for complex foldingMore expensive, lower yields
Cell-free systemsRapid, avoids toxicityCostly for scale-up

The choice depends on research requirements, with E. coli systems often serving as the starting point for initial characterization studies .

How should experiments be designed to assess CrcB homolog function?

Designing experiments to assess CrcB homolog function requires multi-faceted approaches:

  • Begin with sequence analysis and structural prediction to identify putative functional domains

  • Design expression constructs with appropriate tags for detection and purification

  • Establish functional assays based on predicted activities (ion transport, binding studies)

  • Include appropriate controls (related homologs, mutant variants)

  • Consider environmental factors (pH, salt concentration) that might affect protein function

When designing experiments, researchers should be mindful of potential contradictions in results that might arise from variations in experimental conditions, as is common in protein characterization studies .

What are appropriate controls when working with CrcB homologs in cellular models?

When studying CrcB homologs in cellular models, researchers should implement:

Positive controls:

  • Well-characterized CrcB homologs from model organisms

  • Known ion channel proteins with established assays

Negative controls:

  • Cells transfected with empty vectors

  • Inactive mutant versions of the protein

  • Unrelated membrane proteins processed identically

Control selection should consider the specific cell lines used, as research has shown that different colorectal cancer (CRC) cell lines, for example, may display varying responses based on their inherent characteristics .

What purification strategies yield the highest quality CrcB homolog protein?

Purification of membrane proteins like CrcB homologs typically requires:

  • Cell lysis under conditions that maintain native protein conformation

  • Membrane isolation and solubilization using appropriate detergents

  • Affinity chromatography utilizing fusion tags (His, GST, etc.)

  • Size exclusion chromatography to separate monomeric protein from aggregates

  • Quality control through activity assays and structural analyses

The selection of detergents is particularly critical, as inappropriate choices can lead to protein aggregation or denaturation during purification .

How can researchers optimize storage conditions to maintain CrcB homolog activity?

Storage optimization should systematically evaluate:

ConditionVariables to TestMonitoring Method
Temperature-80°C, -20°C, 4°CActivity assays at defined intervals
Buffer compositionpH ranges, salt concentrationsCircular dichroism to assess structural integrity
AdditivesGlycerol, reducing agentsSize exclusion profiles to detect aggregation
Freeze/thawFlash freezing vs. slow coolingFunctional assays before and after cycles

Researchers should establish baseline activity measurements before storage to enable accurate comparisons of different preservation methods .

How should contradictory results in CrcB homolog studies be analyzed and reconciled?

When confronting contradictory results, researchers should:

  • Compare methodological details across studies, including expression systems, purification protocols, and assay conditions

  • Evaluate protein quality metrics (purity, homogeneity, activity) that might explain discrepancies

  • Consider environmental variables that might affect protein behavior

  • Assess whether different structural states or conformations might exist under varying conditions

  • Design targeted experiments to directly address the contradictions

This systematic approach aligns with established practices for resolving contradictions in randomized clinical trials and other complex experimental systems .

What statistical approaches are most appropriate for analyzing functional data from CrcB homolog experiments?

Analysis of functional data should employ:

  • Multiple replicates (minimum n=3, preferably n=5) with appropriate outlier analysis

  • Normality testing before applying parametric statistics

  • Non-linear regression for dose-response relationships

  • ANOVA with post-hoc tests for multiple condition comparisons

  • Correction for multiple hypothesis testing when screening numerous conditions

Researchers should be cautious about pooling analyses (meta-analyses) of conflicting results, as this may obscure important distinctions between experimental conditions, similar to challenges observed in clinical trial research .

How can transcriptomic approaches enhance understanding of CrcB homolog expression and regulation?

Transcriptomic approaches offer powerful insights into CrcB homolog biology:

  • RNA-seq can identify differential expression patterns under varying environmental conditions

  • Metatranscriptomic analyses can reveal expression patterns in natural marine environments

  • Co-expression network analysis can identify functionally related genes

  • Time-course experiments can elucidate regulatory dynamics

These approaches have been successfully applied to marine microbial communities, providing insights into gene expression patterns without constraints imposed by existing sequence data .

What role might the CrcB homolog play in marine bacterial ecological functions?

In marine bacterial communities, CrcB homologs may contribute to:

  • Ion homeostasis in varying salinity environments

  • Stress responses to changing marine conditions

  • Interactions with other microorganisms in the ecosystem

  • Biogeochemical processes in marine environments

Metatranscriptomic studies have revealed gene sequences of biogeochemical interest in marine environments, providing a foundation for understanding the ecological roles of proteins like CrcB homologs .

How can structural biology approaches be applied to understand CrcB homolog function?

Structural biology approaches for membrane proteins like CrcB homologs include:

  • X-ray crystallography, requiring specialized crystallization techniques for membrane proteins

  • Cryo-electron microscopy, increasingly valuable for membrane protein structures

  • Nuclear magnetic resonance for dynamic studies of smaller domains

  • Molecular dynamics simulations based on homology models

  • Hydrogen-deuterium exchange mass spectrometry for conformational studies

These methods can reveal critical insights into the mechanism of action, though they present technical challenges due to the membrane-associated nature of CrcB proteins .

How can CrcB homologs be studied in cellular contexts to understand their biological roles?

Cellular studies of CrcB homologs may employ:

  • Expression in model cell lines with appropriate controls

  • Subcellular localization studies using fluorescent fusion proteins

  • Functional assays in cellular contexts (e.g., ion flux measurements)

  • Knockout/knockdown approaches to assess loss-of-function phenotypes

  • Complementation studies to confirm functional conservation

When selecting cell lines for such studies, researchers should consider established lines with well-characterized properties, such as those commonly used in CRC research (SW620, Caco-2, RKO, etc.) .

What approaches are most effective for studying protein-protein interactions involving CrcB homologs?

Protein-protein interaction studies should employ multiple complementary approaches:

  • Co-immunoprecipitation followed by mass spectrometry identification

  • Yeast two-hybrid screening with appropriate modifications for membrane proteins

  • Proximity labeling approaches (BioID, APEX) for in vivo interaction mapping

  • Fluorescence resonance energy transfer (FRET) for direct interaction assessment

  • Split reporter systems for in vivo validation

Each method has strengths and limitations; concordance between multiple methods provides stronger evidence for genuine interactions .

How can researchers troubleshoot expression and purification challenges with CrcB homologs?

Common challenges and solutions include:

ChallengeTroubleshooting Approach
Low expressionTest different promoters, host strains, and induction conditions
Protein aggregationOptimize detergent selection, buffer composition, and temperature
Poor solubilityConsider fusion partners, solubility tags, or membrane mimetics
Loss of activityEvaluate buffer components, glycerol addition, and reducing agents
Proteolytic degradationAdd protease inhibitors, optimize purification speed

Systematic optimization often requires testing multiple conditions in parallel with quantitative assessment of protein yield and quality at each step .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.