Recombinant Jannaschia sp. Undecaprenyl-diphosphatase (uppP)

What is Undecaprenyl-diphosphatase (uppP) and what is its primary function?

Undecaprenyl-diphosphatase (uppP), also known as Bacitracin resistance protein or Undecaprenyl pyrophosphate phosphatase (EC 3.6.1.27), is an enzyme involved in bacterial cell wall biosynthesis. Its primary function is to convert undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP), which serves as a carrier lipid for peptidoglycan precursors during bacterial cell wall synthesis . This conversion is a critical step in the peptidoglycan biosynthesis pathway, making uppP an essential enzyme for bacterial survival and a potential target for antimicrobial development.

What is the molecular structure of Jannaschia sp. Undecaprenyl-diphosphatase?

The Undecaprenyl-diphosphatase (uppP) from Jannaschia sp. (strain CCS1) consists of 267 amino acids. Its complete amino acid sequence is: MSLFTLFLLALVQGITEFLPISSSGHLILLPNLLGIEDQGQAIDVAVHVGTLGAVILYFW RDVKAAIAGTPRLLTGRIDTPGAKLAFLLIIATIPVIIFGLFLEVTGIYDSLRSIAVIGW TmLIFGLVLYWADQRGGTEKQSDDWSLRDAVTMGLWQAVALIPGTSRSGITITAARFLGY DRESAARVAmLMSIPTIIATGVFAGAEVIATADAQTARDGAIAAALSFLAALAALTLMFR LLKSVSFTPYVIYRVILGVILLVIAYA . The protein is encoded by the gene uppP, with ordered locus name Jann_0247. The structure includes multiple transmembrane domains, consistent with its role as a membrane-bound enzyme involved in cell wall biosynthesis.

How does Undecaprenyl-diphosphatase differ between bacterial species?

While the core catalytic function of Undecaprenyl-diphosphatase remains consistent across bacterial species, significant variations exist in structure and inhibition profiles. For instance, comparing uppP from Jannaschia sp. with UPPP from E. coli reveals differences in amino acid sequences that affect their susceptibility to inhibitors . E. coli UPPP has been studied using a fusion hybrid with Haloarcula marismortui bacteriorhodopsin to maintain activity in detergent-based assays, whereas other bacterial UPPPs may require different experimental approaches. Studies have shown that inhibitors like bacitracin affect different bacterial UPPPs with varying potency, with reported IC50 values of approximately 32 μM for E. coli UPPP .

What methods are used to produce recombinant Jannaschia sp. Undecaprenyl-diphosphatase?

Recombinant Jannaschia sp. Undecaprenyl-diphosphatase is typically produced through heterologous expression systems. The protocol generally involves:

• Cloning the uppP gene (Jann_0247) into an appropriate expression vector

• Transforming the construct into a bacterial expression host (often E. coli)

• Inducing protein expression under optimized conditions

• Extracting and purifying the recombinant protein using techniques such as affinity chromatography

The recombinant protein is often produced with a tag for purification purposes, though the specific tag type may vary depending on the experimental requirements. The purified protein is typically stored in a Tris-based buffer with 50% glycerol to maintain stability . For long-term storage, it is recommended to keep the protein at -20°C or -80°C, avoiding repeated freeze-thaw cycles.

What are the most effective experimental approaches for assessing Undecaprenyl-diphosphatase inhibition?

Assessment of Undecaprenyl-diphosphatase inhibition requires sophisticated experimental approaches that account for its membrane-bound nature. The most effective methods include:

• Detergent-based enzymatic assays: Using purified recombinant enzyme in the presence of detergents that maintain its activity. For example, E. coli UPPP has been successfully studied using a fusion hybrid with bacteriorhodopsin that maintains activity in detergent-based systems .

• Phosphate release assays: Measuring the release of inorganic phosphate from the dephosphorylation of undecaprenyl diphosphate substrates.

• Cell-based synergy studies: Evaluating potential inhibitors in combination with known cell wall biosynthesis inhibitors to identify synergistic effects, which can indicate target specificity. For instance, benzoic acid inhibitors of UPPP demonstrated strong synergism (FICI values of 0.32-0.37) with cell wall biosynthesis inhibitors in both S. aureus and B. subtilis, but showed indifferent effects (FICI values of 1.42-1.47) with non-cell wall targeting antibiotics .

When designing inhibition studies, researchers should establish complete dose-response curves for accurate IC50 determination, as demonstrated in studies of benzoic acid derivatives against S. aureus UPPS and E. coli UPPP .

How do structure-activity relationships influence the design of Undecaprenyl-diphosphatase inhibitors?

Structure-activity relationship (SAR) studies for Undecaprenyl-diphosphatase inhibitors reveal several critical factors that influence inhibitor efficacy:

• Lipophilicity: The optimal logD values for effective inhibitors typically range from 3.0 to 4.7, as demonstrated in studies with benzoic acid derivatives. Compounds with these logD values, such as compound 7 (5-fluoro-2-(3-(octyloxy)benzamido)benzoic acid) with a logD of 3.5, showed potent activity against bacterial growth (ED50 ~ 0.15 μg/mL) and enzyme inhibition .

• Ring substitution patterns: The position and nature of substituents on aromatic rings significantly influence activity. For example, substituents meta to the carboxyl group in benzoic acids with varying Hammett σm values (0 for −H, 0.71 for −NO2) affect the acidity of the carboxyl group, potentially improving its ability to mimic the diphosphate group in natural substrates .

• Functional group bioisosterism: Phosphonic acids sometimes serve as better inhibitors than benzoic acids, likely due to their closer mimicry of the natural substrate's phosphate groups.

The following table shows the correlation between structural properties and inhibitory activity for selected compounds:

These data demonstrate that compounds with balanced lipophilicity and appropriate structural features exhibit the strongest inhibitory effects .

What are the challenges in developing specific assays for Undecaprenyl-diphosphatase activity?

Developing specific assays for Undecaprenyl-diphosphatase activity presents several significant challenges:

• Membrane protein solubilization: As a membrane-bound enzyme, uppP requires careful solubilization to maintain its native conformation and activity. Different detergents and lipid environments must be screened to identify optimal conditions that preserve enzymatic function while allowing for experimental manipulation.

• Substrate availability: The natural substrate, undecaprenyl diphosphate, is a large lipophilic molecule that is challenging to synthesize or isolate in pure form. Many researchers must use synthetic analogs or radioactively labeled substrates, which may not perfectly recapitulate natural kinetics.

• Distinguishing from related phosphatases: Ensuring assay specificity requires careful control experiments to distinguish uppP activity from other phosphatases. This is particularly important when working with crude cell extracts or when characterizing potential inhibitors.

• Reconciling in vitro and in vivo results: Correlating enzyme inhibition with cellular effects requires careful experimental design. Studies have shown good correlations between enzyme inhibition (IC50 values) and bacterial growth inhibition (ED50 values) for compounds that target both UPPS and UPPP, suggesting these assays can be predictive of cellular activity when properly designed .

To address these challenges, researchers have developed specialized approaches, including the use of fusion proteins (such as the E. coli UPPP-bacteriorhodopsin fusion) that enhance stability in detergent-based assays while maintaining catalytic activity .

How can synergistic effects between Undecaprenyl-diphosphatase inhibitors and conventional antibiotics be quantified?

Synergistic effects between Undecaprenyl-diphosphatase inhibitors and conventional antibiotics can be quantified through several established methodologies:

• Fractional Inhibitory Concentration Index (FICI): This is the most widely used method to quantify synergy. FICI values below 0.5 indicate synergism, values between 0.5-4.0 indicate an indifferent or additive effect, and values above 4.0 suggest antagonism. In studies with benzoic acid derivative inhibitors (e.g., compound 7), mean FICI values of 0.32 for S. aureus and 0.37 for B. subtilis were observed when combined with cell wall biosynthesis inhibitors, indicating strong synergism .

• Checkerboard assays: These involve testing various concentrations of two agents in combination to generate an interaction surface. The resulting isobolograms can visually represent synergistic, additive, or antagonistic interactions.

• Time-kill curves: These assays measure bacterial killing over time with single agents versus combinations, providing dynamic information about antimicrobial interactions.

• Mechanistic correlation studies: By testing combinations with antibiotics of known mechanisms, researchers can gain insights into the target pathway of novel inhibitors. For example, compound 7 showed synergism with seven antibiotics targeting cell wall biosynthesis (average FICI~0.35) but indifferent effects with six non-cell wall biosynthesis inhibitors (average FICI~1.45), strongly suggesting its involvement in cell wall biosynthesis pathways .

When interpreting synergy studies, it is crucial to distinguish true mechanistic synergy from additive effects or apparent synergy due to enhanced penetration or reduced efflux of one agent by another.

What role does Undecaprenyl-diphosphatase play in bacterial antibiotic resistance?

Undecaprenyl-diphosphatase plays a critical role in bacterial antibiotic resistance through several mechanisms:

• Bacitracin resistance: UppP/UPPP is also known as "Bacitracin resistance protein" because its overexpression can confer resistance to bacitracin, an antibiotic that binds to undecaprenyl pyrophosphate and prevents its dephosphorylation . Increased uppP activity allows bacteria to maintain sufficient levels of undecaprenyl phosphate for cell wall synthesis despite the presence of bacitracin.

• Cell wall integrity maintenance: By ensuring the recycling of the undecaprenyl carrier lipid, uppP helps maintain cell wall integrity even under antibiotic stress that targets other aspects of cell wall biosynthesis.

• Peptidoglycan modification pathway: UppP activity is essential for the incorporation of modified peptidoglycan precursors that can contribute to resistance against glycopeptide antibiotics such as vancomycin.

Research has demonstrated that inhibitors targeting both UPPS and UPPP pathways can act synergistically with existing cell wall-active antibiotics, potentially overcoming resistance mechanisms . This dual targeting approach represents a promising strategy for developing new antimicrobial agents against resistant bacterial strains.

What are the optimal conditions for expressing and purifying recombinant Jannaschia sp. Undecaprenyl-diphosphatase?

The optimal conditions for expressing and purifying recombinant Jannaschia sp. Undecaprenyl-diphosphatase require careful optimization of several parameters:

• Expression system selection: While E. coli is commonly used for heterologous expression, membrane proteins like uppP often benefit from specialized expression hosts such as C41(DE3) or C43(DE3) strains that are adapted for membrane protein expression. For Jannaschia sp. uppP, codon optimization may be necessary due to the different codon usage between marine bacteria and expression hosts.

• Induction conditions: Typical conditions include:

  • Temperature: 16-25°C (lower temperatures often improve folding of membrane proteins)

  • Inducer concentration: 0.1-0.5 mM IPTG for T7-based systems

  • Induction time: 16-24 hours for membrane proteins

  • Media supplementation: Addition of glycerol (0.5-1%) and specific phospholipids can enhance membrane protein expression

• Membrane extraction and solubilization: Critical steps include:

  • Cell lysis: Gentle methods such as enzymatic lysis with lysozyme followed by mild sonication

  • Membrane isolation: Ultracentrifugation to collect membrane fractions

  • Detergent selection: Typically n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucoside (OG), or digitonin at concentrations just above their critical micelle concentration

  • Solubilization time: 1-2 hours at 4°C with gentle agitation

• Purification strategy: The recombinant Jannaschia sp. uppP is typically stored in a Tris-based buffer with 50% glycerol for stability . For long-term storage, keeping aliquots at -20°C or -80°C is recommended, while working aliquots can be maintained at 4°C for up to one week. Repeated freeze-thaw cycles should be avoided to prevent protein denaturation and loss of activity .

How can researchers develop reliable assays to measure Undecaprenyl-diphosphatase activity?

Developing reliable assays for Undecaprenyl-diphosphatase activity requires careful consideration of the enzyme's membrane-bound nature and substrate specificity. Recommended approaches include:

• Phosphate release assays:

  • Malachite green assay: Measures released inorganic phosphate through formation of phosphomolybdate complexes

  • EnzChek Phosphate Assay: Uses enzymatic coupling to convert released phosphate to a fluorescent product

  • Optimization requirements: Detergent concentration, pH (typically 7.5-8.5), divalent cation concentration (Mg²⁺ or Mn²⁺), and substrate presentation

• Substrate preparation techniques:

  • Undecaprenyl diphosphate incorporation into detergent micelles or liposomes

  • Use of shorter-chain analogs with improved solubility for preliminary studies

  • Substrate concentration optimization (typically 10-100 μM range)

• Activity verification controls:

  • Inclusion of known inhibitors like bacitracin (IC₅₀ ≈ 32 μM for E. coli UPPP)

  • Heat-inactivated enzyme controls

  • Phosphatase inhibitor cocktail controls to rule out contaminating phosphatase activity

• Kinetic analysis approaches:

  • Initial velocity measurements under conditions where substrate depletion is minimal (<10%)

  • Determination of K_m and V_max values using Michaelis-Menten kinetics

  • Evaluation of product inhibition patterns

For inhibitor screening, dose-response curves should be generated over a wide concentration range (typically 0.01-100 μM) to accurately determine IC₅₀ values, as demonstrated in studies with benzoic acid derivatives against SaUPPS and EcUPPP .

What techniques are most effective for studying the membrane topology of Undecaprenyl-diphosphatase?

Studying the membrane topology of Undecaprenyl-diphosphatase requires specialized techniques that can probe protein structure and orientation within the lipid bilayer:

• Computational prediction methods:

  • Hydropathy analysis using algorithms like TMHMM, Phobius, or MEMSAT

  • Evaluation of conserved domain architecture across bacterial species

  • Ab initio modeling and molecular dynamics simulations in membrane environments

• Experimental topology mapping:

  • Cysteine scanning mutagenesis: Systematic replacement of residues with cysteine followed by accessibility testing with membrane-permeable and impermeable thiol-reactive reagents

  • Reporter fusion analysis: Creation of fusion constructs with reporter proteins (e.g., GFP, alkaline phosphatase, β-lactamase) at various positions to determine orientation

  • Protease protection assays: Limited proteolysis of membrane preparations followed by mass spectrometry to identify protected regions

• Structural biology approaches:

  • Cryo-electron microscopy of membrane protein reconstituted in nanodiscs or lipid environments

  • X-ray crystallography of detergent-solubilized protein or lipidic cubic phase crystallization

  • NMR spectroscopy using isotopically labeled protein in detergent micelles or bicelles

• Functional validation methods:

  • Site-directed mutagenesis of predicted functional residues

  • Chimeric protein construction to swap domains between homologs with different properties

  • Cross-linking studies to identify proximity relationships between transmembrane segments

These approaches, particularly when used in combination, can provide complementary information about the membrane topology and structural features of Undecaprenyl-diphosphatase that are critical for its function in bacterial cell wall biosynthesis.

What are the most promising research directions for Undecaprenyl-diphosphatase inhibitor development?

The most promising research directions for Undecaprenyl-diphosphatase inhibitor development include:

• Structure-based drug design: As structural information about bacterial UPPPs becomes more available, rational design of inhibitors targeting specific binding pockets will become increasingly feasible. Computational approaches including molecular docking and dynamics simulations can accelerate this process.

• Dual-target inhibitors: Compounds that can simultaneously inhibit both UPPS and UPPP, such as certain benzoic acid derivatives, show enhanced antibacterial effects and potential to overcome resistance mechanisms. The strong correlation between bacterial growth inhibition and enzyme inhibition for these dual-targeting compounds indicates this is a particularly promising approach .

• Synergistic combinations: Development of UPPP inhibitors specifically designed to work synergistically with existing antibiotics. The demonstrated synergism between compound 7 and cell wall biosynthesis inhibitors (average FICI~0.35) provides proof-of-concept for this approach .

• Species-selective inhibitors: Design of inhibitors that target specific bacterial pathogens while sparing beneficial microbiota, based on structural and functional differences between UPPPs from different bacterial species.

• Novel scaffolds: Moving beyond the established benzoic acid and phosphonic acid scaffolds to identify new chemical classes with improved pharmacokinetic properties, reduced toxicity, and potentially novel binding modes.

Future research in this field will benefit from integration of genomic, structural, computational, and medicinal chemistry approaches to develop novel antimicrobial agents targeting this essential bacterial enzyme.

How might comparative studies between different bacterial Undecaprenyl-diphosphatases advance antimicrobial development?

Comparative studies between different bacterial Undecaprenyl-diphosphatases can significantly advance antimicrobial development through several avenues:

• Identification of conserved catalytic mechanisms: By comparing UPPPs from diverse bacterial species, researchers can identify highly conserved catalytic residues and reaction mechanisms that represent universal targets for broad-spectrum inhibitor development.

• Species-specific targeting opportunities: Conversely, structural and functional differences between UPPPs from different bacterial species can be exploited to develop narrow-spectrum antibiotics that target specific pathogens while minimizing disruption to the microbiome.

• Resistance mechanism elucidation: Comparing UPPPs from sensitive and resistant bacterial strains can reveal natural variations that confer resistance, allowing for preemptive design of inhibitors that remain effective against resistant enzymes.

• Evolutionary insights: Understanding the evolutionary relationships between UPPPs can provide insights into their functional constraints and potential adaptability, informing strategies to minimize resistance development to new inhibitors.

• Translational models: Comparative studies can identify which bacterial models (such as S. aureus, B. subtilis, or E. coli) best represent the properties of UPPPs in difficult-to-study pathogens, facilitating more efficient inhibitor screening and development processes.

The study of benzoic acids and phenylphosphonic acids against S. aureus and B. subtilis growth, along with their inhibitory effects on SaUPPS and EcUPPP, exemplifies how comparative approaches can reveal both broad patterns and species-specific differences in enzyme inhibition and antibacterial activity .