Recombinant Janthinobacterium sp. ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant Janthinobacterium sp. ATP Synthase Subunit b

The subunit b (atpF) forms part of the F₀ domain of ATP synthase, anchoring the F₁ catalytic head to the membrane. Key features include:

Comparative Analysis with Other Species

FeatureJanthinobacterium sp. atpFNostoc sp. atpF
Length (aa)156187
Isoelectric Point9.5 (predicted)8.7 (predicted)
Conserved DomainsMembrane anchor regionExtended C-terminal helix
Expression HostE. coliE. coli
Data derived from UniProt entries A6T474 (Janthinobacterium) and P12407 (Nostoc) .

Production and Purification

Recombinant atpF is synthesized using E. coli expression systems, optimized for high yield and purity:

  • Expression Vector: Full-length atpF cloned into plasmids with inducible promoters (e.g., T7/LacZ) .

  • Purification: Affinity chromatography via His-tag, followed by gel filtration. Purity exceeds 90% as confirmed by SDS-PAGE .

  • Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0). Glycerol (5–50%) is recommended for long-term storage at –80°C .

Role in ATP Synthase Complex

  • Membrane Anchoring: Subunit b connects F₁ (α₃β₃γδε) and F₀ (ab₂c₈–₁₇) domains, ensuring rotational coupling during proton translocation .

  • Proton Channel Regulation: Basic residues in the C-terminus (e.g., Arg₁₆₇, His₁₇₀) are critical for stabilizing interactions with c-subunits in alkaliphilic homologs .

Experimental Applications

  • Enzyme Activity Assays: Used to study ATP hydrolysis inhibition mechanisms in F₀F₁-ATP synthases .

  • Structural Studies: Supports cryo-EM and X-ray crystallography to resolve rotary mechanisms .

Key Studies

  1. Alkaliphilic Adaptations: Mutagenesis of Bacillus homologs revealed conserved lysine/arginine residues in subunit b critical for proton capture at high pH .

  2. Violacein Biosynthesis Link: Janthinobacterium strains producing recombinant atpF show upregulated violacein pathways, suggesting metabolic cross-talk .

  3. Secretion System Interactions: Genomic analyses identify atpF alongside type II/VI secretion systems, implicating ATP synthase in biofilm formation .

Industrial Relevance

  • Biocatalyst Development: High-purity recombinant atpF aids in designing synthetic ATP synthases for bioenergy applications .

  • Antimicrobial Research: Violacein-producing Janthinobacterium strains leverage ATP synthase activity for competitive survival .

Challenges and Future Directions

  • Thermostability: Poor stability above 30°C limits applications in industrial settings .

  • Functional Redundancy: Co-expression with other F₀ subunits (e.g., subunit a) is required to reconstitute proton-coupled activity in vitro .

  • Genetic Engineering: CRISPR-based editing of atpF in Janthinobacterium could optimize violacein yields .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly include them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for the specific delivery time.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
atpF; mma_3631; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Janthinobacterium sp. (strain Marseille) (Minibacterium massiliensis)
Target Names
atpF
Target Protein Sequence
MNLNATLIAQFVVFFILAGFTMKFVWPPLMNALDERAKKIADGLAAAERGKSDLAVAEKRAQAELASAQEAGQKRISDAEKRGQSIIEEAKKTAAEEAARILAAAKADADQQVTQVREALRDQVATLAVKGAEQILKREVNATVHADLLNQLKAEL
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. The ATP synthase subunit b (atpF) is a component of the F(0) channel, forming part of the peripheral stalk, linking F(1) to F(0).
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is ATP synthase subunit b (atpF) and what is its role in bacterial energy metabolism?

ATP synthase subunit b (atpF) is a critical component of the F-type ATP synthase complex, which produces ATP from ADP and inorganic phosphate using energy derived from a transmembrane proton motive force. In bacterial systems like Janthinobacterium sp., the atpF protein functions as part of the peripheral stalk (also called the stator) that connects the membrane-embedded F₀ domain with the catalytic F₁ domain. This structural connection is essential for preventing rotation of the α₃β₃ hexamer during catalysis, allowing the central γ subunit to rotate within it and drive ATP synthesis .

The complete ATP synthase complex in bacteria typically consists of the F₁ subunits (α₃:β₃:γ:δ:ε) and the F₀ domain subunits (a:b:b':c₉), with the b subunit (atpF) playing a key structural role in maintaining the integrity of the complex during its rotary catalytic function . This fundamental role makes atpF essential for bacterial energy homeostasis and cellular viability.

How does the structure of Janthinobacterium sp. atpF compare to other bacterial homologs?

The Janthinobacterium sp. ATP synthase subunit b consists of 156 amino acids and shares structural similarities with other bacterial atpF homologs, though with species-specific variations. The full amino acid sequence (MNLNATLIAQFVVFFILAGFTMKFVWPPLMNALDERAKKIADGLAAAERGKSDLAVAEKRAQAELASAQEAGQKRISDAEKRGQSIIEEAKKTAAEEAARILAAAKADADQQVTQVREALRDQVATLAVKGAEQILKREVNATVHADLLNQLKAEL) reveals characteristic features of bacterial b subunits .

Comparative structural analyses with better-characterized bacterial ATP synthases, such as those from E. coli and Bacillus PS3, show that while the core functions are conserved, there can be significant structural differences in the transmembrane α-helices of subunit b relative to other components like subunit a. Recent cryo-EM studies of bacterial ATP synthases have identified these structural variations, though some apparent differences in earlier lower-resolution studies may have been artifacts rather than true biological differences .

What expression systems are most efficient for recombinant production of Janthinobacterium sp. atpF?

E. coli expression systems have proven to be highly effective for the recombinant production of Janthinobacterium sp. atpF. The commercially available recombinant protein is expressed in E. coli with an N-terminal His-tag to facilitate purification . This approach typically yields protein with greater than 90% purity as determined by SDS-PAGE analysis.

For researchers developing their own expression protocols, several considerations should be addressed:

  • Codon optimization for E. coli may be necessary if rare codons are present in the Janthinobacterium sequence

  • Temperature optimization during induction (typically 16-25°C) can improve soluble protein yield

  • IPTG concentration (usually 0.1-1.0 mM) should be optimized for each construct

  • Expression duration (4-24 hours) affects yield and potential formation of inclusion bodies

When adapting protocols from related ATP synthase subunits, researchers should account for the specific characteristics of the Janthinobacterium sp. variant, including its hydrophobicity profile and potential for aggregation during overexpression.

What are the optimal buffer conditions for maintaining stability of purified atpF protein?

Based on established protocols for similar recombinant proteins, the purified Janthinobacterium sp. atpF protein demonstrates optimal stability in Tris/PBS-based buffers at pH 8.0 with the addition of 6% trehalose as a stabilizing agent . This formulation helps preserve structural integrity during storage and freeze-thaw cycles.

For long-term storage, the addition of 5-50% glycerol (with 50% being the recommended concentration) and storage at -20°C/-80°C in small aliquots is strongly advised to prevent repeated freeze-thaw cycles, which can significantly compromise protein activity and structural integrity .

When developing experimental protocols, researchers should consider the following stability optimization strategies:

Buffer ComponentRecommended RangePurpose
Tris/PBSpH 7.5-8.5Maintains physiological conditions
Trehalose5-10%Prevents denaturation during lyophilization/reconstitution
Glycerol5-50%Cryoprotectant for frozen storage
NaCl100-300 mMMaintains ionic strength
Reducing agent (DTT/BME)1-5 mMPrevents oxidation of cysteine residues

For applications requiring buffer exchange, gradual dialysis is recommended to prevent aggregation, particularly when removing denaturants or detergents that may have been used during purification.

What methods are most appropriate for assessing the structural integrity of recombinant atpF?

Several complementary methods can be employed to assess the structural integrity of recombinant Janthinobacterium sp. atpF:

  • SDS-PAGE Analysis: Provides a basic assessment of protein purity and molecular weight (approximately 17.5 kDa plus the His-tag). Samples should show a predominant band at the expected size with purity >90% .

  • Circular Dichroism (CD) Spectroscopy: Valuable for assessing secondary structure content, particularly the alpha-helical content which is characteristic of ATP synthase b subunits. The expected CD spectrum should show strong negative bands at 208 and 222 nm, indicative of alpha-helical structure.

  • Size Exclusion Chromatography (SEC): Useful for evaluating oligomeric state and detecting aggregation. The atpF protein should elute as a predominant peak corresponding to its monomeric or dimeric form, depending on experimental conditions.

  • Thermal Shift Assays: Can provide information about protein stability under various buffer conditions. This technique is particularly valuable when optimizing storage formulations or when screening stabilizing ligands.

  • Limited Proteolysis: Can reveal information about domain organization and stability. Properly folded atpF should display characteristic proteolytic patterns when subjected to controlled digestion.

For more detailed structural characterization, advanced techniques such as NMR spectroscopy (for solution structure) or X-ray crystallography (for crystal structure) may be employed, though these typically require specialized expertise and equipment.

How can researchers assess the functional activity of recombinant atpF in vitro?

  • Binding Assays with Partner Subunits: Using techniques such as surface plasmon resonance (SPR), microscale thermophoresis (MST), or pull-down assays to measure binding affinities between recombinant atpF and other ATP synthase subunits, particularly the δ subunit and subunit a.

  • Reconstitution into Proteoliposomes: Following methodologies similar to those used for mycobacterial ATP synthase, researchers can reconstitute atpF with other ATP synthase subunits into proteoliposomes and measure functional parameters .

  • Complementation Studies: Using atpF-deficient bacterial strains to assess whether the recombinant protein can restore ATP synthase function in vivo.

  • Structural Studies with Partner Proteins: Performing co-crystallization or cryo-EM studies of atpF in complex with interacting partners to assess proper structural formation.

For researchers working with the complete ATP synthase complex, functional activity can be measured through ATP synthesis assays using NADH-driven systems in inverted membrane vesicles or reconstituted proteoliposomes, as described in studies of mycobacterial ATP synthase .

How can site-directed mutagenesis of atpF be used to investigate ATP synthase function?

Site-directed mutagenesis of Janthinobacterium sp. atpF provides a powerful approach for investigating structure-function relationships within the ATP synthase complex. Strategic mutations can be designed to:

  • Probe Stator Function: Mutations in regions that interact with other subunits can reveal the contribution of specific residues to the stability of the peripheral stalk and its ability to resist torque during catalysis.

  • Investigate Transmembrane Interactions: Mutations in the membrane-spanning region can help elucidate how atpF anchors in the membrane and interacts with other transmembrane subunits, particularly subunit a.

  • Examine Dimerization Interfaces: Since b subunits typically form homodimers (or in some cases, heterodimers with b'), mutations at predicted interaction surfaces can reveal residues essential for oligomerization.

  • Study Conformational Flexibility: Mutations that alter the rigidity or flexibility of key regions can provide insights into how mechanical forces are transmitted through the peripheral stalk during rotary catalysis.

When designing mutagenesis experiments, researchers should consider:

  • Conserved residues identified through sequence alignments with other bacterial b subunits

  • Predicted secondary structure elements and their boundaries

  • Known interaction interfaces from structural studies of related ATP synthases

  • Charged residues that might participate in salt bridges or other electrostatic interactions

The mutated proteins should be characterized using the structural and functional methods described in sections 3.1 and 3.2, with particular attention to how the mutations affect assembly of the complete ATP synthase complex.

What are the key considerations when using atpF as part of structural studies of the complete ATP synthase complex?

When incorporating Janthinobacterium sp. atpF into structural studies of the complete ATP synthase complex, researchers should consider several critical factors:

  • Co-expression Strategies: Rather than purifying individual subunits separately, co-expression of multiple ATP synthase subunits often yields more stable and properly assembled complexes. Expression systems such as those used for Bacillus PS3 ATP synthase in E. coli provide useful models .

  • Detergent Selection: The choice of detergents for solubilizing membrane proteins is crucial for maintaining native structure. Mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) are often effective for ATP synthase complexes.

  • Lipid Environment: The addition of specific lipids during purification or reconstitution can significantly enhance stability and activity. Consideration of the native lipid environment of Janthinobacterium sp. may provide insights into optimal lipid compositions.

  • Rotational State Capture: ATP synthases exist in multiple rotational states. For comprehensive structural studies, strategies to capture different states (such as the use of specific inhibitors or nucleotide analogs) should be considered, as demonstrated in the cryo-EM studies of Bacillus PS3 ATP synthase that revealed three distinct rotational states .

  • Resolution Limitations: As observed in previous studies, lower-resolution structural data can lead to misinterpretation of subunit positions and interactions. Researchers should strive for the highest possible resolution and critically evaluate structural models based on resolution-appropriate confidence levels .

For cryo-EM studies specifically, optimizing sample vitrification conditions, collecting sufficient particle numbers, and employing appropriate image processing algorithms are essential for obtaining high-quality structural data.

How does the Janthinobacterium sp. ATP synthase compare to ATP synthases from pathogenic bacteria as potential drug targets?

While Janthinobacterium sp. itself is not typically considered a significant human pathogen, comparative studies between its ATP synthase and those from pathogenic bacteria can provide valuable insights for antimicrobial drug development. The ATP synthase has emerged as a promising drug target, particularly in mycobacteria, due to its essential role in energy metabolism and the presence of species-specific features that can be selectively targeted .

Key considerations for comparative studies include:

  • Structural Differences: Detailed structural comparisons between Janthinobacterium sp. atpF and its counterparts in pathogenic bacteria can identify unique features that might be exploited for selective inhibition. For example, mycobacterial ATP synthases have specific regulatory elements such as the α subunit C-terminus that are not present in human ATP synthases .

  • Inhibitor Binding Sites: Molecular docking studies using homology models of different bacterial ATP synthases can reveal differences in potential binding pockets that might be exploited for selective inhibition, similar to the approach used in developing inhibitors targeting the mycobacterial α-γ interface .

  • Functional Differences: Comparative functional studies, particularly examining differences in ATP synthesis/hydrolysis regulation, proton conductance, and responses to environmental stressors, can identify species-specific vulnerabilities.

  • Cross-Species Validation: Inhibitors developed against one bacterial ATP synthase should be tested against others to assess specificity and the potential for broad-spectrum activity.

Research has demonstrated the potential of this approach, with compounds like AlMF1 showing inhibitory activity against mycobacterial ATP synthase by targeting the α-γ interface . Similar strategies could be applied using knowledge gained from studies of Janthinobacterium sp. atpF to develop targeted inhibitors of pathogenic bacterial ATP synthases.

What are the most effective methods for reconstitution of lyophilized atpF protein?

For optimal reconstitution of lyophilized Janthinobacterium sp. atpF protein, the following protocol is recommended:

  • Briefly centrifuge the vial containing lyophilized protein to ensure the material is collected at the bottom of the tube.

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add water slowly while gently swirling or tapping the vial to promote even dissolution without excessive agitation that might denature the protein .

  • For long-term storage, add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation). This serves as a cryoprotectant for frozen storage .

  • Aliquot the reconstituted protein into smaller volumes to avoid repeated freeze-thaw cycles, which significantly reduce protein stability and activity.

  • Store aliquots at -20°C/-80°C for long-term storage, or at 4°C for up to one week if the protein will be used regularly .

If the protein will be used in specific buffer conditions different from the reconstitution buffer, a gradual buffer exchange using dialysis or desalting columns is recommended rather than direct dilution, which can cause precipitation, especially with membrane-associated proteins like atpF.

What analytical methods are most suitable for studying interactions between atpF and other ATP synthase subunits?

Several complementary analytical methods are particularly valuable for studying the interactions between atpF and other ATP synthase subunits:

  • Co-immunoprecipitation (Co-IP): Using antibodies against His-tagged atpF or other subunit-specific antibodies to pull down protein complexes and identify interacting partners via Western blotting or mass spectrometry.

  • Surface Plasmon Resonance (SPR): Allows real-time measurement of binding kinetics between immobilized atpF and other subunits in solution, providing quantitative data on association and dissociation rates.

  • Isothermal Titration Calorimetry (ITC): Provides thermodynamic parameters of binding interactions, including binding affinity, enthalpy, and stoichiometry.

  • Cross-linking Mass Spectrometry (XL-MS): Chemical cross-linking followed by mass spectrometry analysis can identify specific residues involved in subunit interactions, providing spatial constraints for structural modeling.

  • Förster Resonance Energy Transfer (FRET): When applied to fluorescently labeled subunits, FRET can provide information about proximity and dynamics of interacting components in reconstituted systems.

  • Analytical Ultracentrifugation (AUC): Useful for determining the stoichiometry and stability of multi-subunit complexes under various conditions.

  • Native Mass Spectrometry: Can provide information about intact complexes and their stoichiometry under near-native conditions.

Researchers should consider combining multiple methods to build a comprehensive understanding of interaction networks, as each technique has its strengths and limitations. For instance, structural data from cryo-EM studies of bacterial ATP synthases have revealed important insights about subunit interactions that complement functional biochemical studies .

How does the evolutionary conservation of atpF across bacterial species inform structural and functional studies?

Evolutionary analysis of ATP synthase subunit b (atpF) across bacterial species provides valuable insights for structural and functional studies:

  • Conserved Domains: Sequence alignment across diverse bacterial species reveals highly conserved regions that likely play critical functional roles. These conserved domains often include:

    • The membrane-spanning N-terminal region

    • The dimerization interface

    • Interaction surfaces with other subunits, particularly the δ subunit

  • Structural Predictions: Patterns of evolutionary conservation can guide structural predictions, especially for regions that have been difficult to resolve in direct structural studies. Highly conserved residues often form the core structural elements or functionally important interaction sites.

  • Functional Adaptation: Species-specific variations in less conserved regions may reflect adaptations to different physiological conditions or energy requirements. For example, thermophilic bacteria often show adaptations in their ATP synthases that enhance stability at high temperatures.

  • Co-evolution Analysis: Identifying co-evolving residues within atpF or between atpF and other subunits can provide insights into functionally important interactions that maintain the structural integrity and mechanical coupling within the ATP synthase complex.

Comparative structural studies between different bacterial ATP synthases, such as those from E. coli, Bacillus PS3, and chloroplasts, have revealed both conserved architectural features and striking differences in conformational states and regulatory mechanisms . These comparative approaches continue to enhance our understanding of the fundamental mechanisms of rotary ATP synthesis across diverse organisms.

What insights can be gained by comparing bacterial atpF with its counterparts in archaea and eukaryotes?

Comparative analysis of ATP synthase subunit b across domains of life reveals fundamental insights into the evolution and diversification of energy conversion mechanisms:

  • Architectural Differences: While bacterial ATP synthases typically have a relatively simple peripheral stalk comprising homodimers of b subunits (or b/b' heterodimers), eukaryotic mitochondrial ATP synthases have evolved more complex peripheral stalks with additional subunits. These architectural differences reflect adaptations to different membrane environments and regulatory requirements.

  • Functional Conservation: Despite structural differences, the core function of the peripheral stalk—providing a stationary connection between F₀ and F₁ domains—is conserved across all domains of life, highlighting its fundamental importance to the rotary mechanism.

  • Regulatory Adaptations: Comparing regulatory mechanisms across domains reveals how energy conservation strategies have evolved. For example, the mycobacteria-specific C-terminal extension of the α subunit that regulates ATP hydrolysis represents a lineage-specific adaptation to maintain ATP homeostasis under challenging environmental conditions .

  • Targetable Differences: From a therapeutic perspective, structural and sequence differences between bacterial atpF and human mitochondrial counterparts provide potential opportunities for developing selective antimicrobial agents, similar to the strategy employed in targeting mycobacterial-specific features .

  • Evolutionary Transitions: Examining ATP synthase components across the tree of life provides insights into major evolutionary transitions, including the origin of eukaryotes and the endosymbiotic acquisition of mitochondria and chloroplasts.

These comparative studies contribute not only to our fundamental understanding of bioenergetics but also to the development of targeted antimicrobial strategies that exploit domain-specific features of ATP synthases.

What are common challenges in working with atpF and how can they be addressed?

Researchers working with recombinant Janthinobacterium sp. atpF may encounter several challenges that require specific troubleshooting approaches:

  • Protein Aggregation:

    • Problem: atpF contains a hydrophobic transmembrane domain that can cause aggregation during expression or after purification.

    • Solution: Optimize detergent type and concentration during purification, consider using fusion tags that enhance solubility, and ensure appropriate buffer conditions with stabilizing agents like trehalose.

  • Low Expression Yields:

    • Problem: Membrane proteins often express poorly in heterologous systems.

    • Solution: Test different E. coli strains (e.g., C41(DE3) or C43(DE3) designed for membrane proteins), optimize induction conditions (lower IPTG concentration, lower temperature), or consider expression in cell-free systems.

  • Improper Folding:

    • Problem: Recombinant expression may result in misfolded protein.

    • Solution: Co-express with chaperones, optimize growth temperature during induction, or consider refolding protocols if the protein is recovered from inclusion bodies.

  • Proteolytic Degradation:

    • Problem: atpF may be susceptible to proteolysis during expression or purification.

    • Solution: Use protease-deficient E. coli strains, include protease inhibitors during purification, and optimize purification to minimize processing time.

  • Instability After Reconstitution:

    • Problem: Lyophilized protein may lose activity after reconstitution.

    • Solution: Reconstitute immediately before use when possible, optimize buffer conditions based on stability assays, and avoid repeated freeze-thaw cycles .

  • Difficulty in Functional Assessment:

    • Problem: As a single subunit, atpF lacks enzymatic activity on its own.

    • Solution: Develop binding assays with partner subunits, or work toward reconstitution of partial or complete ATP synthase complexes for functional studies.

Each of these challenges may require empirical optimization for the specific experimental context, and researchers should document conditions systematically to identify optimal parameters.

How can researchers optimize conditions for structural studies of atpF-containing complexes?

Optimizing conditions for structural studies of atpF-containing complexes requires attention to several critical parameters:

  • Sample Homogeneity:

    • Challenge: Heterogeneity in protein complexes significantly limits resolution in structural studies.

    • Approach: Implement rigorous size-exclusion chromatography as a final purification step, consider gradient ultracentrifugation to separate different assembly states, and use negative-stain EM to assess sample quality before proceeding to cryo-EM.

  • Conformational Stabilization:

    • Challenge: ATP synthase exists in multiple conformational states, leading to structural heterogeneity.

    • Approach: Use nucleotide analogs, inhibitors, or crosslinking strategies to capture specific states, similar to approaches used in structural studies of Bacillus PS3 ATP synthase that captured three distinct rotational states .

  • Detergent Selection:

    • Challenge: Detergents can destabilize complexes or create artifacts.

    • Approach: Screen multiple detergents and consider newer approaches like nanodiscs, amphipols, or styrene-maleic acid copolymer lipid particles (SMALPs) that better preserve the native membrane environment.

  • Lipid Composition:

    • Challenge: Native lipids are often essential for stability and function.

    • Approach: Consider adding specific lipids during purification or reconstitution, based on the native lipid environment of Janthinobacterium sp.

  • Cryo-EM Grid Optimization:

    • Challenge: Membrane proteins often show preferential orientation in vitreous ice.

    • Approach: Test different grid types (holey carbon, graphene oxide, etc.), optimize blotting conditions, and consider additives that affect surface tension.

  • Data Collection Strategy:

    • Challenge: Higher resolution requires optimal imaging conditions.

    • Approach: Collect large datasets with appropriate defocus ranges, use energy filters to enhance contrast, and employ the latest motion correction and CTF estimation algorithms.

Research on bacterial ATP synthases has demonstrated that high-resolution structural data can provide unprecedented insights into the mechanism of these molecular machines, but achieving such results requires meticulous optimization of each step in the workflow .

What emerging technologies might advance our understanding of atpF function in the ATP synthase complex?

Several emerging technologies hold promise for advancing our understanding of atpF function in the ATP synthase complex:

  • Time-Resolved Cryo-EM: This developing methodology could capture short-lived conformational states during the rotary catalytic cycle, providing insights into how atpF contributes to the mechanical stability of the complex during energy conversion.

  • Single-Molecule Techniques: Methods such as single-molecule FRET and high-speed atomic force microscopy (HS-AFM) can reveal dynamic aspects of ATP synthase function that are obscured in ensemble measurements, potentially capturing the elastic deformation of the peripheral stalk during rotation.

  • In-Cell Structural Biology: Techniques like cryo-electron tomography (cryo-ET) with subtomogram averaging could eventually allow visualization of ATP synthases in their native cellular environment, revealing how membrane composition and cellular organization influence function.

  • Integrative Modeling Approaches: Combining data from multiple experimental methods (cryo-EM, crosslinking mass spectrometry, molecular dynamics simulations) can provide more complete models of the entire ATP synthase complex, including regions that are difficult to resolve by any single method.

  • Artificial Intelligence for Structure Prediction: As demonstrated by recent advances in protein structure prediction, AI-based approaches might help model conformational states or interactions that are challenging to capture experimentally.

  • Synthetic Biology Approaches: Engineered ATP synthases with modified subunits could provide insights into functional requirements and potentially lead to novel applications in bioenergetics or nanomotor development.

These technological advances, particularly when applied in combination, have the potential to resolve remaining questions about how the structural elements of atpF contribute to the remarkable mechanical properties of the ATP synthase molecular motor.

How might research on Janthinobacterium sp. atpF contribute to developing novel antibacterial compounds?

Research on Janthinobacterium sp. atpF has several potential pathways to contribute to antibacterial drug development:

  • Structural Comparison with Pathogenic Species: Detailed structural characterization of Janthinobacterium sp. atpF can provide a comparative framework for identifying unique features in ATP synthases from pathogenic bacteria. These structural differences could be exploited for selective targeting, similar to the approach that identified the mycobacteria-specific α C-terminus as a druggable target .

  • Pharmacophore Model Development: Knowledge of interaction interfaces between atpF and other subunits could inform the development of pharmacophore models for virtual screening campaigns, as demonstrated in the successful identification of the ATP synthase inhibitor AlMF1 .

  • Mechanism-Based Inhibitor Design: Understanding how atpF contributes to the mechanical coupling between F₀ and F₁ domains could inspire the design of compounds that specifically disrupt this coupling, potentially leading to a new class of ATP synthase inhibitors.

  • Allosteric Inhibitor Development: Identifying allosteric sites in atpF that affect ATP synthase function could provide novel targets for inhibitor development, potentially offering advantages in terms of selectivity or mechanism of action compared to active site inhibitors.

  • Cross-Species Validation Platform: Recombinant systems expressing atpF from different bacterial species could serve as a platform for evaluating the species-specificity of potential inhibitors, helping to prioritize compounds with desired activity profiles.

The successful targeting of the mycobacterial ATP synthase through structure-based drug design approaches demonstrates the feasibility of this strategy . Similar approaches focused on atpF and its interactions could yield new classes of antibacterial compounds with novel mechanisms of action—an important goal given the growing challenge of antimicrobial resistance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.