Recombinant Janthinobacterium sp. Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Definition and Source

Recombinant Janthinobacterium sp. plsY is a full-length, His-tagged protein (UniProt ID: A6SV70) expressed in E. coli . It belongs to the acyltransferase family (pfam 01553) and catalyzes the transfer of acyl groups to glycerol-3-phosphate (G3P), forming lysophosphatidic acid (LPA) .

ParameterDetails
Gene NameplsY
SynonymsGPAT, LPA synthase, Acyl-PO4 G3P acyltransferase
OrganismJanthinobacterium sp. (strain Marseille)
Expression SystemE. coli
Amino Acid SequenceMNTVLFALGAYLIGSISFAVVVSKCFRLADPRSYGSKNPGATNVLRSGNKKAAILTLLGD... (201 residues)

Enzymatic Function and Mechanism

plsY catalyzes the reaction:
G3P + acyl-CoA → LPA + CoA
This rate-limiting step in glycerolipid biosynthesis determines fatty acid composition at the sn-1 position of glycerolipids . Key features include:

  • Substrate preference: Utilizes long-chain acyl-CoA donors (C16:0, C18:1) .

  • Regulatory role: Modulates triacylglycerol (TAG) and membrane phospholipid ratios .

  • Evolutionary conservation: Shares 29.71% identity with Saccharomyces cerevisiae GPATs .

Biochemical Properties

Data from recombinant protein specifications :

PropertyValue
Molecular Weight~23 kDa (calculated)
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water + 50% glycerol
StabilityWorking aliquots stable at 4°C for 1 week; avoid freeze-thaw cycles

Lipid Engineering

plsY homologs in Arabidopsis (AtGPAT1) and Aurantiochytrium (PLAT2) demonstrate roles in:

  • Pollen development via ER membrane remodeling .

  • DHA-rich TAG synthesis by preferentially acylating polyunsaturated fatty acids .

Industrial Relevance

  • Biocatalysis: Potential for tailored lipid production in microbial systems .

  • Structural studies: Conserved motifs enable rational engineering of substrate specificity .

Comparative Analysis with Homologs

SpeciesGPAT IsoformFunctionKey Difference
Janthinobacterium sp.plsYTAG/membrane lipid synthesisBacterial origin; soluble expression
Arabidopsis thalianaAtGPAT1Pollen development, ER lipid traffickingMembrane-bound; plant-specific regulation
Saccharomyces cerevisiaeGPT2Phospholipid biosynthesisMitochondrial localization

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them when placing your order. We will endeavor to accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. Should you require dry ice shipping, please inform us beforehand. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you may use as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
plsY; mma_0477; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Janthinobacterium sp. (strain Marseille) (Minibacterium massiliensis)
Target Names
plsY
Target Protein Sequence
MNTVLFALGAYLIGSISFAVVVSKCFRLADPRSYGSKNPGATNVLRSGNKKAAILTLLGD GAKGFLAVWLVKHFGPGYGVHENGVALVAIAVFLGHLWPVFFRFVGGKGVATALGVLLAL NGWLGLATLVTWLVIAYAFRYSSLAALIAAIFAPFYYGLLFGPDVILLAVLAMSILLVYR HSKNIGNLLAGKESRLGSKKK
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of PlsY in bacterial phospholipid biosynthesis?

PlsY functions as an integral membrane acyltransferase that transfers acyl groups from acylphosphate to glycerol-3-phosphate in bacterial membrane phospholipid biosynthesis pathways . This enzyme represents one of the most widely distributed biosynthetic pathways to initiate phosphatidic acid formation in bacterial membrane phospholipid synthesis . The reaction catalyzed by PlsY is part of a two-step process where acyl-acyl carrier protein is first converted to acylphosphate by PlsX, followed by the transfer of the acyl group to glycerol-3-phosphate by PlsY .

This acyltransferase activity sits at the critical interface between soluble type II fatty acid biosynthesis and the creation of phospholipid molecules that drive membrane expansion . This pivotal position makes glycerol-phosphate acyltransferases like PlsY key regulators of both fatty acid and phospholipid synthesis in bacterial systems .

How does the membrane topology of PlsY influence its function?

The membrane topology of PlsY has been extensively studied using the substituted cysteine accessibility method in Streptococcus pneumoniae . Research has revealed that PlsY contains five membrane-spanning segments with its amino terminus and two short loops positioned on the external face of the membrane . The cytoplasmic side contains three larger domains, each harboring a highly conserved sequence motif that is critical for catalytic function .

This specific membrane architecture positions the active site domains appropriately within the cytoplasm while anchoring the enzyme within the membrane where its lipid substrates are located. The multiple membrane-spanning segments ensure proper orientation and stabilization within the bacterial membrane, which is essential for accessing both the water-soluble glycerol-3-phosphate and the lipid-soluble acyl donor substrates .

What are the conserved domains in PlsY and their significance?

PlsY contains three highly conserved sequence motifs located in its cytoplasmic domains, each playing distinct roles in the enzyme's function :

  • Motif 1: Contains essential serine and arginine residues critical for catalysis . Site-directed mutagenesis has demonstrated that these residues are indispensable for enzymatic activity.

  • Motif 2: Exhibits characteristics of a phosphate-binding loop . Mutations of the conserved glycines in this motif to alanines resulted in a Km defect for glycerol-3-phosphate binding, indicating that this region corresponds to the glycerol-3-phosphate binding site .

  • Motif 3: Contains a conserved histidine and asparagine that are important for catalytic activity, along with a glutamate that is critical to the structural integrity of the enzyme .

These conserved domains represent potential targets for structural studies and drug development, as they are essential for the enzyme's function and likely conserved across bacterial species including Janthinobacterium sp.

What expression systems are most effective for recombinant PlsY production?

For recombinant expression of integral membrane proteins like PlsY, several expression systems can be considered, each with specific advantages:

Bacterial Expression Systems: Escherichia coli remains a common choice for recombinant protein expression due to its rapid growth, easy genetic manipulation, and cost-effectiveness . For PlsY expression, E. coli systems would require optimization of membrane protein expression techniques, possibly using specialized strains designed for membrane protein production. Codon optimization can increase recombinant protein expression by many folds, which is particularly important when expressing genes with rare codons .

Yeast Expression Systems: Yeasts such as Saccharomyces cerevisiae and Pichia pastoris offer advantages for membrane protein expression due to their eukaryotic cellular organization while maintaining relatively simple culture requirements . These systems provide capabilities for post-translational modifications and can achieve proper folding of complex proteins . For PlsY expression, yeast systems may offer better membrane integration, though bacterial proteins might require optimization for expression in eukaryotic hosts.

Cell-Free Expression Systems: Though not specifically mentioned in the search results, cell-free systems can be valuable for toxic or difficult-to-express membrane proteins like PlsY.

When expressing recombinant Janthinobacterium sp. PlsY, researchers should consider using a CRISPR/Cas9-engineered expression system, particularly in yeast, which has shown promise for facilitating expression of complex proteins through site-specific gene integration .

How can protein solubility and stability be optimized for recombinant PlsY?

Optimizing the solubility and stability of recombinant PlsY requires careful consideration of its membrane-bound nature and specific biochemical properties:

  • Detergent Selection: As an integral membrane protein with five membrane-spanning segments , PlsY requires appropriate detergents for extraction and purification. A systematic screening of detergents (nonionic, zwitterionic, and ionic) should be performed to identify optimal conditions that maintain protein stability and activity.

  • Expression Temperature Modulation: Lower expression temperatures (16-25°C) can improve proper folding and reduce inclusion body formation for membrane proteins.

  • Fusion Tags Selection: Utilizing solubility-enhancing fusion partners such as MBP (maltose-binding protein) or SUMO (small ubiquitin-like modifier) can improve folding and solubility while enabling affinity purification .

  • Buffer Optimization: Developing stabilizing buffer systems containing appropriate glycerol concentrations, salt conditions, and pH is critical for maintaining PlsY in a functional state after purification.

  • Redox Environment Control: Ensuring a proper redox environment with appropriate disulfide isomerases (Dsb proteins) and peptidyl-prolyl isomerases (PPIase) can enhance correct folding .

For particularly challenging expression scenarios, high-throughput screening approaches similar to those described for enzyme variants could be adapted to optimize PlsY expression conditions .

What are the methodological considerations for functional assays of recombinant PlsY?

Developing robust functional assays for recombinant PlsY involves several methodological considerations:

  • Substrate Preparation: Both acylphosphate and glycerol-3-phosphate substrates must be prepared or sourced in high purity. The acylphosphate substrate is particularly unstable and may require fresh preparation or stabilization strategies.

  • Activity Measurement Methods: Activity can be measured by monitoring:

    • Consumption of substrates using HPLC or spectrophotometric methods

    • Formation of the 1-acylglycerol-3-phosphate product using TLC, mass spectrometry, or radioisotope-labeled substrates

    • Coupled enzyme assays that link PlsY activity to a spectrophotometrically detectable reaction

  • Inhibition Studies: As PlsY is noncompetitively inhibited by palmitoyl-CoA , inhibition studies can provide valuable mechanistic insights and confirm proper folding and function of the recombinant enzyme.

  • Kinetic Analysis: Determination of kinetic parameters (Km, Vmax, kcat) for both substrates is essential for comparing wild-type and mutant variants or enzymes from different bacterial species.

  • Reconstitution into Liposomes: For more physiologically relevant assays, reconstitution of purified PlsY into liposomes of defined composition can allow assessment of activity in a membrane environment.

The development of miniaturized high-throughput assay formats, similar to those described for the enzyme PafA , could significantly accelerate PlsY characterization studies by enabling parallel testing of multiple conditions or enzyme variants.

How can the membrane topology of Janthinobacterium sp. PlsY be experimentally determined?

The membrane topology of Janthinobacterium sp. PlsY can be experimentally determined using several complementary approaches:

  • Substituted Cysteine Accessibility Method (SCAM): This approach, successfully used for Streptococcus pneumoniae PlsY , involves:

    • Creating a cysteine-less version of PlsY as a background

    • Introducing individual cysteine residues at different positions throughout the protein

    • Determining the accessibility of each cysteine to membrane-impermeant and membrane-permeant thiol-reactive reagents

    • Mapping accessible positions to either cytoplasmic, membrane-spanning, or external domains

  • Fusion Protein Approach: Creating fusions with reporter proteins like alkaline phosphatase (PhoA) or green fluorescent protein (GFP) at different positions to determine orientation based on reporter activity or fluorescence.

  • Protease Protection Assays: Using proteases to digest exposed regions of the protein in intact membrane vesicles, followed by mass spectrometry analysis of protected fragments.

  • Epitope Insertion and Antibody Accessibility: Inserting epitope tags at various positions and determining their accessibility to antibodies in intact cells versus permeabilized cells.

The combination of these methods provides a comprehensive map of PlsY membrane topology, which is essential for understanding structure-function relationships and for designing targeted mutagenesis experiments .

What computational tools and approaches can predict structural features of PlsY?

Several computational tools and approaches can be employed to predict structural features of Janthinobacterium sp. PlsY:

These computational approaches, combined with experimental data on membrane topology and functional residues, can generate testable hypotheses about the structural features of Janthinobacterium sp. PlsY.

How does site-directed mutagenesis inform the catalytic mechanism of PlsY?

Site-directed mutagenesis has been instrumental in elucidating the catalytic mechanism of PlsY by identifying critical residues in each of its three conserved motifs . A methodological approach to using site-directed mutagenesis includes:

  • Target Selection: Based on sequence conservation and predicted functional importance, residues in each conserved motif can be selected for mutation. For PlsY, this has revealed:

    • Essential serine and arginine residues in Motif 1 that are critical for catalysis

    • Conserved glycines in Motif 2 that affect glycerol-3-phosphate binding, as evidenced by Km defects when mutated to alanines

    • A conserved histidine and asparagine in Motif 3 important for activity, and a glutamate critical for structural integrity

  • Mutation Design Strategy:

    • Conservative substitutions (e.g., Ser→Thr, Arg→Lys) to test the importance of specific chemical properties

    • Non-conservative substitutions (e.g., Ser→Ala) to test the absolute requirement for a functional group

    • Charge reversals (e.g., Arg→Glu) to test electrostatic interactions

  • Functional Analysis of Mutants:

    • Kinetic parameter determination (Km, kcat) to distinguish between effects on substrate binding versus catalysis

    • Stability assessment to differentiate between catalytic defects and structural disruption

    • Substrate specificity alterations to map the substrate binding pocket

When applying this approach to Janthinobacterium sp. PlsY, comparing results with the characterized S. pneumoniae enzyme can highlight species-specific differences in catalytic mechanism or substrate preference.

What techniques can be used to study substrate specificity of Janthinobacterium sp. PlsY?

Investigating the substrate specificity of Janthinobacterium sp. PlsY requires a multifaceted approach:

  • Substrate Analog Testing: Synthesizing and testing a range of acylphosphate analogs with varying:

    • Acyl chain lengths (short, medium, long)

    • Degrees of saturation (saturated vs. unsaturated)

    • Branching patterns or functional group modifications

  • Kinetic Characterization: Determining kinetic parameters (Km, Vmax, kcat/Km) for each substrate to quantitatively assess preference and catalytic efficiency.

  • Competition Assays: Measuring activity with the preferred substrate in the presence of potential alternative substrates to assess relative binding affinities.

  • Inhibition Studies: As PlsY is noncompetitively inhibited by palmitoyl-CoA , studying the inhibition patterns with different acyl-CoA species can provide indirect insights into substrate binding site characteristics.

  • High-Throughput Screening: Adapting microfluidic or chip-based high-throughput screening methods similar to those described for enzyme variants could enable rapid testing of substrate preferences across many conditions.

  • In Silico Docking: Computational docking of various substrates to a PlsY structural model can generate hypotheses about binding modes and preferences for experimental validation.

Understanding substrate specificity is particularly important for comparing Janthinobacterium sp. PlsY to other bacterial PlsY enzymes and could reveal adaptations specific to Janthinobacterium's ecological niche or membrane composition requirements.

How can high-throughput mutagenesis approaches be applied to PlsY functional studies?

High-throughput mutagenesis approaches can significantly accelerate functional studies of Janthinobacterium sp. PlsY:

  • Deep Mutational Scanning: This approach involves:

    • Creating a library of PlsY variants with mutations at many or all positions

    • Expressing these variants in a suitable host system

    • Selecting or screening for function using growth complementation or activity assays

    • Deep sequencing to identify enriched or depleted variants

  • Microfluidic/Nanoliter-Scale Assays: The technology described for enzyme studies using "printers to deposit microscopic spots of synthetic DNA coding for the enzyme that we want onto a slide and then align nanoliter-sized chambers filled with the protein starter mix over the spots" could be adapted for PlsY variants.

  • Automated Mutation Design and Analysis:

    • Using computational tools to prioritize positions for mutagenesis based on conservation, structural models, or evolutionary coupling analysis

    • Employing robotic systems for parallel mutation construction, expression, and purification

    • Utilizing automated activity assays for consistent measurement across many variants

  • CRISPR/Cas9-Based Approaches: CRISPR/Cas9 technology, which has been successfully applied for yeast engineering , could be adapted for creating and testing PlsY variants in suitable host organisms.

These high-throughput approaches could reveal, as was found with the enzyme PafA, that "mutations well beyond the active site affected its ability to catalyze chemical reactions" and that "a surprising number of mutations caused [the enzyme] to misfold into an alternate state that was unable to perform catalysis" . Such findings would provide a comprehensive understanding of structure-function relationships in Janthinobacterium sp. PlsY.

How does Janthinobacterium sp. PlsY compare structurally to PlsY from other bacterial species?

A comprehensive structural comparison between Janthinobacterium sp. PlsY and PlsY from other bacterial species requires several analytical approaches:

  • Sequence-Based Comparisons:

    • Multiple sequence alignment of PlsY proteins from diverse bacterial species including well-characterized ones like S. pneumoniae PlsY

    • Phylogenetic analysis to understand evolutionary relationships

    • Conservation scoring of residues to identify universally conserved versus species-specific features

  • Domain Architecture Analysis:

    • Comparison of the five membrane-spanning segments identified in S. pneumoniae PlsY

    • Assessment of the three conserved motifs in cytoplasmic domains

    • Identification of any additional domains or features unique to Janthinobacterium sp.

  • Experimental Structural Comparisons:

    • Circular dichroism spectroscopy to compare secondary structure content

    • Limited proteolysis patterns to identify domain boundaries and flexible regions

    • Cross-linking studies to compare tertiary structure interactions

  • Computational Structural Analysis:

    • Homology modeling based on any available experimental structures

    • Comparison of predicted structures using structural alignment tools

    • Analysis of surface electrostatics and hydrophobicity to identify functional differences

Understanding the structural similarities and differences between Janthinobacterium sp. PlsY and other bacterial PlsYs provides context for functional studies and potential insights into species-specific adaptations.

What methodological approaches can characterize the kinetic differences between PlsY enzymes from different bacterial species?

To characterize kinetic differences between PlsY enzymes from different bacterial species including Janthinobacterium sp., researchers should employ the following methodological approaches:

  • Standardized Enzymatic Assays:

    • Develop consistent assay conditions applicable across different PlsY enzymes

    • Ensure identical substrate preparations and quality control

    • Utilize the same detection methods to enable direct comparisons

  • Comprehensive Kinetic Parameter Determination:

    • Measure Km, Vmax, and kcat for both acylphosphate and glycerol-3-phosphate substrates

    • Determine substrate specificity profiles using various acyl chain donors

    • Analyze product inhibition patterns

    • Study temperature and pH optima and stability profiles

  • Inhibitor Sensitivity Profiling:

    • Compare susceptibility to known inhibitors like palmitoyl-CoA

    • Screen potential species-selective inhibitors that may exploit structural differences

    • Determine inhibition constants (Ki) and mechanisms (competitive, noncompetitive, uncompetitive)

  • Transient Kinetics Studies:

    • Use stopped-flow or quenched-flow techniques to resolve fast reaction steps

    • Identify rate-limiting steps in catalysis for different species' enzymes

  • Structure-Function Correlation:

    • Create chimeric enzymes with domains swapped between species to identify regions responsible for kinetic differences

    • Perform site-directed mutagenesis to convert key residues between species and assess impact on kinetics

The resulting data can be organized in comparative tables as shown below:

Table 1: Comparative Kinetic Parameters of PlsY Enzymes from Different Bacterial Species

SpeciesKm Glycerol-3-P (μM)Km Acylphosphate (μM)kcat (s^-1)kcat/Km G3P (M^-1 s^-1)Temperature Optimum (°C)pH Optimum
Janthinobacterium sp.[Value][Value][Value][Value][Value][Value]
S. pneumoniae[Value][Value][Value][Value][Value][Value]
S. aureus[Value][Value][Value][Value][Value][Value]
Other species[Value][Value][Value][Value][Value][Value]

This comprehensive kinetic characterization would highlight evolutionary adaptations and potentially identify species-specific features that could be exploited for antimicrobial development.

How can recombinant PlsY be used as a target for antimicrobial drug discovery?

Recombinant Janthinobacterium sp. PlsY can serve as a valuable target for antimicrobial drug discovery through several methodological approaches:

  • High-Throughput Inhibitor Screening:

    • Develop a miniaturized, automation-compatible assay for PlsY activity

    • Screen compound libraries against purified recombinant PlsY

    • Incorporate counterscreens against human enzymes to identify selective inhibitors

    • Utilize the nanoliter-scale technology described for enzyme variants to maximize screening efficiency

  • Structure-Based Drug Design:

    • Generate structural models of PlsY based on experimental data and computational prediction

    • Perform virtual screening of compound libraries against the active site or allosteric sites

    • Design inhibitors targeting the essential residues identified in Motifs 1, 2, and 3

    • Develop transition-state analogs based on the catalytic mechanism

  • Fragment-Based Approach:

    • Screen fragment libraries for weak binders to different sites on PlsY

    • Link or grow fragments to develop higher-affinity inhibitors

    • Use biophysical techniques (NMR, SPR, thermal shift assays) to characterize binding

  • Comparative Inhibition Studies:

    • Test inhibitors against PlsY from multiple bacterial species to identify broad-spectrum or species-selective compounds

    • Focus on inhibitors that exploit conserved features like the phosphate-binding loop in Motif 2

    • Investigate the noncompetitive inhibition mechanism observed with palmitoyl-CoA for developing allosteric inhibitors

  • Physiological Validation:

    • Confirm that identified inhibitors can penetrate bacterial membranes

    • Demonstrate on-target activity in whole cells through genetic approaches (e.g., PlsY overexpression should increase inhibitor MIC)

    • Assess impact on phospholipid synthesis using radiolabeled precursors

This integrated approach leverages the essential nature of PlsY in bacterial phospholipid biosynthesis and its absence in humans to develop potentially novel antimicrobial agents.

What emerging technologies can accelerate PlsY enzyme engineering for biotechnological applications?

Several emerging technologies can significantly accelerate PlsY enzyme engineering for biotechnological applications:

  • CRISPR/Cas9-Based Engineering Systems:

    • Precise genome editing capabilities for host strain optimization

    • Multiplexed mutagenesis of PlsY residues for directed evolution

    • CRISPR interference (CRISPRi) for tunable expression control

    • CRISPR activation (CRISPRa) for enhanced expression levels

  • Advanced Protein Design Algorithms:

    • Computational design of PlsY variants with altered substrate specificity

    • Machine learning approaches trained on enzyme variant data to predict beneficial mutations

    • De novo design of catalytic sites with novel functions

  • Microfluidic High-Throughput Screening:

    • Nanoliter-scale reaction chambers for testing thousands of PlsY variants simultaneously

    • Droplet-based microfluidics for single-variant encapsulation and analysis

    • Automated systems that "enable thousands of tiny experiments to run simultaneously on a single polymer chip"

  • Cell-Free Expression Systems:

    • Rapid prototyping of PlsY variants without transformation and cell growth steps

    • Direct accessibility to reaction conditions for screening

    • Simplified workflow for membrane protein production

  • Synthetic Biology Tools for Expression Optimization:

    • Synthetic promoters and ribosome binding sites for fine-tuned expression

    • Codon optimization strategies to enhance expression levels

    • Secretion signal engineering for improved protein localization

  • Advanced Structural Analysis:

    • Cryo-electron microscopy for membrane protein structure determination

    • Hydrogen-deuterium exchange mass spectrometry for dynamics and conformational changes

    • Single-molecule FRET for real-time observation of conformational states

These technologies, when integrated into a comprehensive workflow, can rapidly accelerate the engineering of Janthinobacterium sp. PlsY for applications such as biocatalysis, biosensors, or the production of novel phospholipids with biotechnological value.

How can systems biology approaches integrate PlsY function into broader metabolic networks?

Systems biology approaches can effectively integrate Janthinobacterium sp. PlsY function into broader metabolic networks through several methodological strategies:

This systems-level understanding can reveal how PlsY activity is coordinated with other cellular processes, particularly since glycerol-phosphate acyltransferases like PlsY are "key regulators of both fatty acid and phospholipid synthesis" due to their position at the interface between fatty acid biosynthesis and membrane phospholipid formation.

How can researchers troubleshoot expression and purification issues with recombinant PlsY?

Researchers encountering expression and purification challenges with recombinant Janthinobacterium sp. PlsY can implement the following methodological troubleshooting approaches:

  • Low Expression Levels:

    • Optimize codon usage for the expression host, as "codon optimization increases the expression of recombinant protein by many folds"

    • Test multiple promoter strengths and induction conditions

    • Evaluate different fusion tags that can enhance expression and solubility

    • Consider specialized expression hosts designed for membrane proteins

    • Address potential toxicity by using tightly regulated expression systems or secretion strategies

  • Inclusion Body Formation:

    • Lower induction temperature to slow protein synthesis and improve folding

    • Co-express molecular chaperones to assist proper folding

    • Use solubility-enhancing fusion partners

    • Optimize growth media composition and induction timing

    • Develop refolding protocols if inclusion bodies cannot be avoided

  • Protein Aggregation During Purification:

    • Screen multiple detergents systematically for extraction and purification

    • Optimize buffer conditions (pH, salt concentration, glycerol content)

    • Include stabilizing additives like specific lipids from Janthinobacterium membranes

    • Maintain samples at appropriate temperatures throughout purification

    • Consider on-column folding strategies for improved recovery

  • Low Enzymatic Activity:

    • Verify proper folding using biophysical techniques (circular dichroism, fluorescence spectroscopy)

    • Ensure preservation of critical residues in the three conserved motifs essential for catalysis

    • Test activity with various substrates in case of substrate specificity differences

    • Optimize assay conditions thoroughly (pH, temperature, ionic strength)

    • Assess potential inhibitory substances in the purification buffers

  • Poor Membrane Integration:

    • Evaluate expression systems like yeast that may provide better membrane protein folding environments

    • Consider cell-free expression systems with supplied lipids or nanodiscs

    • Use GFP fusion approaches to monitor proper membrane localization in vivo

These troubleshooting strategies should be approached systematically, with careful documentation of conditions and outcomes to identify optimal parameters for successful expression and purification of functional Janthinobacterium sp. PlsY.

What are the key considerations for resolving contradictory results in PlsY functional studies?

When facing contradictory results in Janthinobacterium sp. PlsY functional studies, researchers should consider the following methodological approaches:

  • Experimental Validation and Replication:

    • Repeat experiments with rigorous controls under identical conditions

    • Perform experiments in different laboratories to confirm reproducibility

    • Use multiple complementary techniques to measure the same parameter

    • Implement blinded experimental designs where appropriate

  • Substrate and Enzyme Quality Assessment:

    • Verify the purity and stability of substrates (acylphosphate is particularly unstable)

    • Confirm protein homogeneity using multiple analytical methods (SDS-PAGE, size exclusion chromatography, mass spectrometry)

    • Assess the proportion of properly folded versus misfolded enzyme, as studies have shown that "a surprising number of mutations caused [enzymes] to misfold into an alternate state that was unable to perform catalysis"

    • Validate enzyme activity with established control reactions

  • Methodological Differences Analysis:

    • Compare assay conditions in detail (pH, temperature, buffer components, detergents)

    • Evaluate differences in expression systems and purification methods

    • Consider the impact of fusion tags or modified protein constructs

    • Assess differences in enzyme concentration or substrate-to-enzyme ratios

  • Species and Strain Verification:

    • Confirm the genetic identity of the Janthinobacterium sp. strain used

    • Sequence verify the PlsY construct to rule out mutations or polymorphisms

    • Consider potential differences between wild-type and recombinant proteins

  • Data Analysis and Statistical Approaches:

    • Apply appropriate statistical tests to determine significance of differences

    • Consider whether outliers should be included or excluded based on objective criteria

    • Evaluate whether contradictions may be due to different data analysis methods

    • Assess whether different kinetic models were applied to the same data

Table 2: Systematic Approach to Resolving Contradictory Results in PlsY Studies

Contradiction TypePotential CausesResolution StrategyValidation Method
Substrate specificity differencesEnzyme preparation variationStandardize expression and purificationSide-by-side testing with multiple substrates
Activity level discrepanciesMisfolded protein proportionOptimize folding conditionsBiophysical characterization of protein state
Inhibition pattern conflictsDifferences in assay componentsSystematic buffer component analysisInhibition studies with controlled conditions
Kinetic parameter disagreementsDifferent analysis methodsApply multiple kinetic modelsGlobal fit analysis of raw data

By systematically addressing these considerations, researchers can resolve contradictions and establish a consistent understanding of Janthinobacterium sp. PlsY function.

What novel experimental approaches could provide deeper insights into PlsY catalytic mechanism?

Several innovative experimental approaches could significantly advance our understanding of the Janthinobacterium sp. PlsY catalytic mechanism:

  • Time-Resolved X-ray Crystallography:

    • Capture intermediate states during catalysis

    • Visualize conformational changes upon substrate binding

    • Identify water molecules involved in catalysis

    • Map the precise positions of the essential residues in Motifs 1, 2, and 3

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Monitor protein dynamics during substrate binding and catalysis

    • Identify regions that undergo conformational changes

    • Compare dynamics of wild-type and mutant variants

    • Track changes in solvent accessibility in different functional states

  • Single-Molecule FRET Studies:

    • Observe real-time conformational changes during catalysis

    • Determine the sequence and timing of events in the catalytic cycle

    • Identify potential rate-limiting steps

    • Examine the effects of inhibitors on protein dynamics

  • Vibrational Spectroscopy:

    • Use infrared spectroscopy to track bond formation and breaking during catalysis

    • Apply Raman spectroscopy to monitor conformational changes

    • Implement time-resolved approaches to capture transient intermediates

    • Utilize isotope labeling to follow specific chemical groups

  • Quantum Mechanics/Molecular Mechanics (QM/MM) Simulations:

    • Model the electronic structure of the active site during catalysis

    • Calculate energy barriers for different proposed reaction mechanisms

    • Predict the roles of specific residues in catalysis

    • Test the effects of mutations computationally

  • Ancestral Sequence Reconstruction:

    • Resurrect ancestral PlsY enzymes to track evolutionary changes in mechanism

    • Identify how catalytic efficiency has been optimized through evolution

    • Understand the development of substrate specificity

These approaches, particularly when combined in an integrated research program, could resolve key questions about how the three conserved motifs in PlsY cooperate to catalyze the acyltransferase reaction and how substrate specificity is determined at the molecular level.

How might PlsY research contribute to understanding bacterial membrane adaptation mechanisms?

Research on Janthinobacterium sp. PlsY can provide significant insights into bacterial membrane adaptation mechanisms through several research avenues:

  • Environmental Adaptation Studies:

    • Investigate how PlsY activity and substrate preference change under different environmental conditions (temperature, pH, osmolarity)

    • Examine expression regulation of PlsY in response to environmental stressors

    • Compare PlsY function in Janthinobacterium sp. isolated from different ecological niches

    • Correlate PlsY activity with membrane fluidity adjustments in response to environmental changes

  • Membrane Composition Analysis:

    • Apply lipidomics to track changes in acyl chain composition of phospholipids under different conditions

    • Correlate these changes with PlsY substrate preference and activity

    • Investigate how PlsY selectivity for acyl chains influences membrane physical properties

    • Examine how "the selectivity of [acyltransferases] for particular acyl chains is responsible for the positional asymmetry in the fatty acid composition" of bacterial membranes

  • Regulatory Network Mapping:

    • Identify regulatory elements controlling PlsY expression and activity

    • Map the signaling pathways that modulate PlsY function in response to environmental changes

    • Determine how PlsY activity is coordinated with other enzymes in phospholipid synthesis

    • Investigate potential post-translational modifications that might regulate PlsY activity

  • Comparative Studies Across Species:

    • Compare PlsY function and regulation across bacterial species from different environments

    • Identify adaptations specific to psychrophilic, thermophilic, or halophilic bacteria

    • Examine whether species with multiple PlsY homologs (like Bacillus anthracis with its three PlsY homologs ) use them for different membrane adaptation scenarios

  • Genetic Manipulation Studies:

    • Create PlsY variants with altered substrate specificity and assess their impact on membrane properties

    • Develop strains with regulated PlsY expression to study membrane adaptation dynamics

    • Implement CRISPR/Cas9 technology for precise genome editing to study PlsY in its native regulatory context

These research approaches would leverage the pivotal position of PlsY at "the interface between the soluble type II fatty acid biosynthetic pathway and the creation of a phospholipid molecule that drives membrane expansion," which "makes the glycerol-phosphate acyltransferases key regulators of both fatty acid and phospholipid synthesis" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.