Recombinant Janthinobacterium sp. Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; mma_3272; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Janthinobacterium sp. (strain Marseille) (Minibacterium massiliensis)
Target Names
mscL
Target Protein Sequence
MGMMQEFKEFAVKGNVVDLAVAVIVGAAFGKIVDSLVQDVIMPVVGKIFGGLDFSNYYIA LNNQDPNLTLVEAKKLGAVLAYGNFITIALNFIILAFIIFQMVRLLNKLKRTEPPAPEEP AAVPEDIALLREIRDSLKK
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces in the lipid bilayer. It likely plays a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Janthinobacterium sp. and what are its key characteristics?

Janthinobacterium species are gram-negative bacteria known for producing violacein, a purple pigment with antimicrobial properties. Janthinobacterium sp. strain SLB01 was isolated from diseased sponge Lubomirskia baikalensis in Lake Baikal. These bacteria contain genes for violacein biosynthesis (vioABCDE) and possess the ability to form strong biofilms. The genomes of Janthinobacterium strains contain the type VI secretion system (T6SS), which serves as a main virulence factor. Recent genomic comparisons have shown significant similarity between Janthinobacterium sp. strains and the previously described strain Janthinobacterium lividum MTR .

J. lividum specifically produces anti-Batrachochytrium dendrobatidis metabolites including violacein and indole-3-carboxaldehyde, with minimum inhibitory concentrations (MIC) of 1.82 μM and 69 μM, respectively . These metabolites demonstrate significant antifungal activity that has been correlated with survival of amphibian species in laboratory and field studies .

What are mechanosensitive channels and what is their biological function?

Mechanosensitive channels function as molecular transducers of mechanical force exerted on the cell membrane. These specialized protein channels open in response to membrane bilayer deformations that occur during physiological processes including touch, hearing, blood pressure regulation, and osmoregulation .

In bacteria specifically, mechanosensitive channels form safety valves that protect cells from hypoosmotic shock by opening wide pores under membrane tension to relieve excessive turgor pressure within the cell . The mechanosensitive channel of large conductance (MscL) responds to membrane tension of approximately 10-12 mN/m and has a very high nonselective conductance of approximately 3 nS, making it ideal for rapid pressure equalization during osmotic stress .

How do mechanosensitive channels respond to mechanical stress?

Mechanosensitive channels directly respond to tension in the lipid bilayer of the cell membrane. For MscL specifically, the tension required to induce gating in patch clamp experiments is around 12 dynes/cm . When sufficient membrane tension is applied, the channel undergoes conformational changes that lead to the opening of a water-filled pore, allowing the passage of solutes and small molecules across the membrane .

These structural rearrangements can be studied using techniques such as fluorescence resonance energy transfer (FRET) spectroscopy under conditions that mimic physiological environments. Researchers can control the state of the pore by modifying the lateral pressure distribution via the lipid bilayer, allowing for precise measurement of structural changes during channel opening . The transition to the open state appears to be less dramatic than initially proposed in earlier models, with the N-terminus remaining anchored at the membrane surface where it can translate membrane tension to conformational changes in the pore-lining helix .

What are the current methods for studying MscL gating mechanisms?

Several sophisticated techniques have been developed to study MscL gating mechanisms:

Patch Clamp Electrophysiology: Enables direct measurement of channel activity under controlled membrane tension. For MscL, functional recordings typically require tension of 10-12 mN/m to observe channel opening events .

Fluorescence Resonance Energy Transfer (FRET): Allows measurement of structural rearrangements in the protein under similar conditions to patch clamp recordings while maintaining the channel in its natural lipid environment .

Electron Paramagnetic Resonance (EPR): Provides critical information about inter-subunit distances and solvent accessibility of specific protein regions during gating .

Molecular Dynamics Simulations: Both atomistic and coarse-grained (CG) models are employed to simulate channel gating over extended timescales. CG simulations particularly address the timescale limitations of traditional MD by grouping several atoms into single particles, allowing for microsecond-range simulations with enhanced sampling efficiency .

Brownian Dynamics Simulations: Complementary to molecular dynamics, these simulations are useful for studying larger scale motions and longer timescale phenomena relevant to channel gating .

The most informative approach involves combining multiple techniques, as demonstrated in studies where FRET data obtained under physiological conditions was integrated with simulations to determine the open state structure of MscL .

How can recombinant MscL from Janthinobacterium sp. be expressed for structural studies?

While the search results don't specifically describe expression protocols for Janthinobacterium sp. MscL, methodological approaches can be derived from general membrane protein expression strategies and the specific techniques used in MscL studies:

Expression Systems: E. coli expression systems with inducible promoters are commonly used for bacterial membrane proteins. The MscL gene can be amplified from Janthinobacterium sp. genomic DNA using PCR and cloned into appropriate expression vectors.

Protein Purification: After expression, membrane fractionation with detergents suitable for maintaining MscL structure and function is necessary. Affinity chromatography, typically utilizing histidine tags, can be employed for purification.

Functional Verification: Patch clamp recordings of the purified and reconstituted protein can verify whether the recombinant channel maintains mechanosensitivity with expected conductance properties (approximately 3 nS) .

Reconstitution Systems: For structural studies, reconstitution into liposomes or nanodiscs with defined lipid compositions provides a controlled environment that mimics the native membrane.

The specific properties of Janthinobacterium sp. may require optimization of expression conditions, detergent selection, and reconstitution parameters to maintain native channel function.

What computational approaches are effective for modeling MscL structure and function?

Based on successful research strategies, several computational approaches have proven effective for modeling MscL:

Coarse-Grained (CG) Simulations: These address the timescale limitations of traditional MD simulations by grouping multiple atoms into single particles. This reduction in system complexity allows for simulations in the microsecond range and demonstrates enhanced sampling efficiency for conformational changes .

Restrained Molecular Dynamics: Incorporating experimental data as restraints in simulations has been particularly valuable. Studies have successfully used inter-subunit distances and solvent accessibility data from EPR and FRET experiments as restraints in CG models, allowing researchers to induce gating and model the open pore structure without applying excessive tension .

Multiple Simulation Approach: Running multiple simulations in the microsecond range achieves greater conformational sampling and can reveal structural changes not observable in single shorter simulations .

Physiologically Relevant Tension Parameters: Simulations can be performed using different tension values, such as 12 dynes/cm (matching the tension required for gating in patch clamp experiments) or higher values like 30 dynes/cm when necessary to induce gating within feasible simulation timeframes .

This combined approach has successfully generated open pore models consistent with experimental data and provided insights into the structural rearrangements during gating that would be difficult to obtain through experimental methods alone .

What is the current understanding of the open-channel structure of MscL?

The current understanding of MscL's open-channel structure has been significantly enhanced through studies combining FRET spectroscopy with computational modeling. Key structural features include:

Pore Configuration: The transition to the open state appears less dramatic than previously proposed in some models. The channel forms an expanded and stable water-filled pore when opened fully .

N-terminal Domain Position: The N-terminus remains anchored at the surface of the membrane during channel opening, where it can either guide the tilt of or directly translate membrane tension to conformational changes in the pore-lining helix .

Transmembrane Helices: Structural rearrangements primarily involve the transmembrane helices, particularly the pore-lining helices that undergo tilting and expansion to create the open channel .

Channel Dimensions: While specific dimensions aren't detailed in the search results, the large conductance (approximately 3 nS) indicates a substantial pore diameter in the open state .

These structural insights have been obtained through approaches that allow measurement of protein conformational changes under conditions similar to those used in patch clamp recordings, while controlling the pore state in its natural lipid environment .

How do different domains of MscL contribute to tension sensing and gating?

Different domains of the MscL protein play distinct roles in tension sensing and channel gating:

Transmembrane Domains: The first transmembrane domain (TM1) primarily lines the pore, while the second transmembrane domain (TM2) interacts with the lipid bilayer and is involved in sensing membrane tension .

N-Terminal Domain: This region remains anchored at the membrane surface during gating and plays a crucial role in translating membrane tension to conformational changes in the pore-lining helix . This finding challenges earlier models that proposed more dramatic rearrangements of this domain.

Loop Regions: While not specifically detailed in the search results, loop regions connecting the transmembrane domains typically contribute to the flexibility required for the substantial conformational changes during gating.

Channel Symmetry: MscL forms a homopentameric structure, with each subunit contributing to tension sensing and the coordinated conformational changes required for pore opening .

Understanding these domain-specific contributions has been enhanced by combining experimental techniques like FRET with computational approaches that can model the dynamic changes occurring during channel gating .

How does membrane composition affect MscL function in Janthinobacterium sp.?

While the search results don't provide specific information about the effects of membrane composition on MscL function in Janthinobacterium sp., general principles from MscL research suggest important considerations:

Lateral Pressure Profile: Studies highlight the importance of the lateral pressure distribution in the lipid bilayer for controlling MscL gating . Different lipid compositions would alter this distribution, potentially affecting the tension threshold required for channel opening.

Membrane Thickness: The hydrophobic mismatch between the transmembrane domains of MscL and the lipid bilayer thickness can influence channel function. Variations in membrane thickness could affect the energetics of the conformational changes required for gating.

Physiological Environment: Research emphasizes the importance of studying MscL in its natural lipid environment for accurate functional characterization . The native membrane composition of Janthinobacterium sp. may have evolved to optimize MscL function for its specific ecological niche.

Understanding these membrane effects would require comparative studies using recombinant Janthinobacterium sp. MscL reconstituted in artificial membranes of varying composition or expressed in different host systems.

How does MscL in Janthinobacterium sp. compare to MscL in other bacterial species?

Although the search results don't provide direct comparisons between MscL in Janthinobacterium sp. and other bacteria, general comparative principles can be derived:

Structural Conservation: The basic pentameric structure and core gating mechanism of MscL appear to be conserved across bacterial species. Studies often use homology models based on well-characterized MscL channels, such as those from E. coli (Eco-MscL) or M. tuberculosis (Tb-MscL) .

Species-Specific Adaptations: Different bacterial species may show variations in MscL sequence and specific functional properties, potentially reflecting adaptation to their particular ecological niches. Janthinobacterium species inhabit diverse environments, from freshwater lakes to amphibian skin , which might influence MscL properties.

Experimental Considerations: Researchers often choose which MscL homolog to study based on experimental goals. For instance, studies have used Eco-MscL homology models instead of Tb-MscL crystal structures when working with experimental restraints derived from E. coli MscL .

A comprehensive comparison would require sequence analysis, functional characterization, and structural studies of MscL from Janthinobacterium sp. alongside other well-characterized MscL channels.

What distinguishes large-conductance from small-conductance mechanosensitive channels?

Based on the available information, several key differences distinguish large-conductance mechanosensitive channels (MscL) from small-conductance mechanosensitive channels (MscS):

Conductance Magnitude: MscL exhibits significantly higher conductance (approximately 3 nS) compared to MscS channels .

Tension Threshold: MscL requires higher membrane tension (10-12 mN/m) to activate compared to MscS channels, which respond to lower tension thresholds .

Structural Differences: While both channel types respond to membrane tension, they have distinct structural arrangements and gating mechanisms.

Physiological Roles: MscL acts as a final emergency release valve during severe osmotic shock, while MscS channels may be involved in more sensitive responses to smaller osmotic changes .

Co-existence in Bacterial Species: Many bacteria possess both channel types, suggesting complementary functions. For example, Laribacter hongkongensis contains one large conductance mechanosensitive channel (LHK_02562) and four small conductance mechanosensitive channels (LHK_01830, LHK_01942, LHK_02394, and LHK_02965) .

This diversity of mechanosensitive channels likely allows bacteria to respond appropriately to varying degrees of osmotic stress with graduated responses.

How might understanding MscL in Janthinobacterium contribute to antibiotic research?

Understanding MscL in Janthinobacterium species could provide several valuable insights for antibiotic research:

Violacein Production Connection: Janthinobacterium species produce violacein, which has demonstrated antimicrobial properties. For example, J. lividum produces violacein with an MIC of 1.82 μM against the fungal pathogen Batrachochytrium dendrobatidis . Potential connections between MscL function and antimicrobial metabolite production could reveal novel therapeutic approaches.

Bacterial Survival Mechanisms: Understanding how MscL contributes to Janthinobacterium survival under environmental stress could identify new vulnerability targets for antimicrobial development.

Drug Delivery Strategies: MscL channels could potentially serve as entry points for novel antibiotics under specific conditions, similar to how aminoglycosides enter bacteria through mechanosensitive channels during osmotic downshock.

Biofilm Formation: Janthinobacterium sp. SLB01 contains genes for strong biofilm formation . If MscL plays a role in biofilm development or maintenance, this could suggest new strategies for disrupting biofilms, which are often highly resistant to conventional antibiotics.

Virulence Regulation: The presence of the type VI secretion system (T6SS) as a main virulence factor in Janthinobacterium sp. raises questions about potential interactions between mechanosensation and virulence expression.

What experimental designs would best assess MscL function in the context of Janthinobacterium's ecological roles?

To effectively investigate MscL function in relation to Janthinobacterium's ecological roles, several experimental approaches could be employed:

Host-Association Studies: Since Janthinobacterium species have been found associated with amphibians and produce protective metabolites like violacein , experiments could examine MscL function during host colonization. This might include:

  • Creating MscL knockout strains and assessing colonization efficiency

  • Monitoring MscL expression during different stages of host association

  • Measuring osmotic stress responses in the host-associated environment

Biofilm Formation Analysis: Given that Janthinobacterium sp. SLB01 contains genes for strong biofilm formation :

  • Compare biofilm formation between wild-type and MscL-deficient strains

  • Examine MscL expression and function within biofilm structures

  • Assess how osmotic challenges affect biofilm integrity with functional or modified MscL

Environmental Adaptation Experiments: For species found in freshwater environments like Lake Baikal :

  • Test MscL function under varying osmotic conditions mimicking environmental fluctuations

  • Examine temperature-dependent changes in MscL activity relevant to seasonal changes

  • Measure competitive fitness of MscL variants in simulated environmental conditions

Violacein Production Correlation: To explore connections between mechanosensation and secondary metabolite production:

  • Measure violacein production under conditions that activate or inhibit MscL

  • Assess whether MscL mutations affect violacein biosynthesis gene expression

  • Determine if osmotic stress responses coordinate with antimicrobial compound production

These experimental approaches would provide a comprehensive understanding of how MscL contributes to Janthinobacterium's success in its diverse ecological niches.

How can recombinant MscL be used to develop novel biosensors or biotechnological applications?

Recombinant MscL from Janthinobacterium sp. offers several promising biotechnological applications:

Tension-Activated Biosensors: MscL could be engineered to couple mechanical forces to detectable outputs, creating nanoscale biosensors that respond to physical parameters in various environments.

Controlled Release Systems: The large pore size and defined gating mechanism of MscL make it potentially valuable for developing systems that release compounds in response to specific mechanical stimuli.

Drug Delivery Vehicles: Liposomes or vesicles incorporating engineered MscL could enable targeted delivery of therapeutic compounds that are released upon reaching tissues or cellular environments with specific mechanical properties.

Environmental Monitoring Tools: Given Janthinobacterium's presence in freshwater systems , MscL-based sensors could be developed to monitor environmental parameters relevant to water quality assessment.

Integration with Violacein Production: The natural coupling of recombinant MscL with violacein-producing capabilities could create systems that produce antimicrobial compounds in response to mechanical triggers.

Mechanobiological Research Platforms: Recombinant MscL serves as an excellent model system for studying fundamental principles of mechanobiology, with insights potentially transferable to more complex eukaryotic mechanosensitive systems involved in touch, hearing, and blood pressure regulation .

Developing these applications would require robust expression systems, careful protein engineering to modify gating properties as needed, and appropriate reconstitution methods to maintain channel function in the desired experimental or application context.

What are the main challenges in expressing and characterizing recombinant MscL from Janthinobacterium sp.?

Expressing and characterizing recombinant MscL from Janthinobacterium sp. likely presents several technical challenges:

Membrane Protein Expression Difficulties: As with many membrane proteins, achieving sufficient expression of correctly folded MscL can be challenging. The hydrophobic nature of transmembrane domains often leads to protein aggregation or misfolding.

Purification Stability: Maintaining MscL stability during extraction from the membrane and subsequent purification steps requires careful optimization of detergents and buffer conditions.

Functional Reconstitution: Ensuring the recombinant channel retains its native mechanosensitive properties when reconstituted into artificial lipid bilayers for functional studies.

Species-Specific Properties: Janthinobacterium sp. may have unique lipid requirements or post-translational modifications affecting MscL function that need to be accounted for in heterologous expression systems.

Consistent Tension Application: Developing systems that apply consistent and quantifiable membrane tension for functional characterization.

Potential solutions to these challenges include:

  • Screening multiple expression systems and optimization of induction conditions

  • Employing fusion tags or protein engineering approaches to improve stability

  • Systematic testing of detergent and lipid combinations for optimal reconstitution

  • Developing standardized tension application methods for consistent functional assessment

  • Using multiple complementary techniques (FRET, patch clamp, computational modeling) as demonstrated in previous MscL studies

How can researchers reconcile differences between in vitro and in vivo findings on MscL function?

Addressing discrepancies between in vitro and in vivo findings requires systematic approaches:

Physiological Membrane Environment: Studies emphasize the importance of examining MscL in its natural lipid environment . Researchers should aim to use native-like lipid compositions in in vitro studies or develop methods for measurements in living cells.

Appropriate Tension Parameters: Apply physiologically relevant tension in in vitro studies. Using tension values that match those required for gating in patch clamp experiments (approximately 12 dynes/cm) rather than excessive tension can help align with physiological conditions .

Integration of Multiple Methodologies: Combining techniques provides more comprehensive insights. For example, integrating FRET data obtained under physiological conditions with simulations has proven valuable for studying conformational changes in membrane proteins .

Restraint-Based Simulations: Incorporating experimental restraints from techniques like EPR and FRET into simulations guides them toward physiologically relevant conformations, as demonstrated in research that modeled the open pore without using excessive tension .

Consideration of Cellular Context: Account for potential interactions with other cellular components that might be missing in simplified in vitro systems but could influence channel function in vivo.

By carefully addressing these considerations, researchers can build a more complete and physiologically relevant understanding of MscL function that reconciles in vitro experimental data with in vivo behavior.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.