Recombinant Janthinobacterium sp. Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to YidC in Bacterial Systems

YidC is an evolutionarily conserved membrane protein insertase critical for the biogenesis of α-helical membrane proteins. It functions either independently as a chaperone/insertase or cooperatively with the Sec translocon . In Escherichia coli, YidC facilitates the co-translational insertion of membrane proteins at the ribosome exit tunnel, mediating interactions between nascent chains and the lipid bilayer . Homologs exist in mitochondria (Oxa1) and chloroplasts (Alb3), underscoring its universal importance .

2.1. Core Architecture

YidC typically contains five transmembrane helices (TM1–TM5) arranged to form a hydrophilic groove. This groove serves as a substrate-binding site and interacts with ribosomes during co-translational insertion . Key structural observations include:

  • Hydrophilic Environment: A conserved groove lined with polar residues facilitates interactions with substrate proteins’ polar termini .

  • Membrane Thinning: Molecular dynamics simulations show YidC induces localized bilayer thinning (~7–10 Å), reducing energy barriers for substrate insertion .

  • Crystal Structures: The E. coli YidC structure (PDB: 3WVF) reveals a periplasmic domain absent in Gram-positive homologs like Bacillus halodurans YidC .

2.2. Ribosome Interaction

Cryo-EM studies demonstrate that a single YidC monomer binds near the ribosomal tunnel exit, positioning substrates at the protein-lipid interface for insertion . Key contact points involve ribosomal proteins L23 and L29 .

3.1. Substrate Spectrum

YidC mediates insertion of:

  • Sec-Independent Proteins: Single-pass (e.g., Pf3 coat protein) and small multi-pass membrane proteins (e.g., F0c) .

  • Sec-Dependent Proteins: Larger polytopic proteins requiring SecYEG translocon cooperation .

3.2. Key Functional Partners

Partner ProteinRole in YidC FunctionExample OrganismSource
YibNEnhances substrate insertion efficiency; stabilizes YidC-lipid interactionsE. coli
SecYEGForms holotranslocon for Sec-dependent substratesStreptococcus mutans
SRP/FtsYCoordinates co-translational targetingS. mutans

Recombinant YidC Applications

While no studies explicitly describe recombinant Janthinobacterium YidC, insights from E. coli and B. subtilis systems suggest potential applications:

  • Membrane Protein Production: Recombinant YidC improves yields of difficult-to-express membrane proteins (e.g., ATP synthase subunit c) .

  • Lipid Scramblase Activity: YidC homologs exhibit lipid bilayer remodeling, which could be exploited for synthetic membrane engineering .

Research Gaps and Future Directions

  1. Species-Specific Variations: Structural/functional differences between Janthinobacterium YidC and homologs (e.g., E. coli) remain uncharacterized.

  2. Interaction Networks: Whether Janthinobacterium YidC associates with partners like YibN or SecYEG is unknown.

  3. Biotechnological Potential: Recombinant Janthinobacterium YidC could be tested for unique substrate preferences or stability under diverse conditions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yidC; mma_3694; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-564
Protein Length
full length protein
Species
Janthinobacterium sp. (strain Marseille) (Minibacterium massiliensis)
Target Names
yidC
Target Protein Sequence
MDIKRTVLWVVFSFSLLMLWDNYNRYTGKPSIFFDNPTTQAAKPAAATDDGKTAAAPTAD VPTSSAHAANATGVPDSVAPTKSEIVTITTDLIKADIDTVGGEIRHLELLTHHESSDSTK DIVLFDSTPPRTYLGQTGLIGGAYPNHKSLFTVRPGPRSLEAGDQVQLVLEAEQNGVKLV KTYTFKRGEYKIDIKHDVINKTAAAINPSLYLQLVRDGSKLNNESMFYSTFTGPAVYSDS DKFQKVTFESIEKGKIEHVVKAESGWIAMVQHYFVSAFVPPANVPREYFTKKLATNLYAV GAIMPMGAVAPGATQSMDATLYSGPQESKRLEAVAPGFELVKDYGWLTIIAKPIFWLMIQ IHQLLGNWGWTIVVLTIVIKLAFFPLSAASYRSMAKMKLVTPKMTEIRTKYKGEPQKMNA AMMELYKKEKINPLGGCMPIVIQIPVFISLYWVLLASVEMRNAPWLWISDLASPDTLFGS YMIGSFHLTIGILPILMAISMFIQTKLNPTPPDPIQAKVMMFMPIAFSLMFFFFPAGLVL YWVVNNILSIAQQWTISKKMGIVN
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. It facilitates the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, as well as certain lipoproteins. Furthermore, it assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its fundamental function in bacterial cells?

The YidC family is conserved across bacteria, with homologs such as SpoIIIJ and YidC2 (YqjG) in Bacillus subtilis that function through similar mechanisms. These proteins play critical roles in the biogenesis of respiratory chain complexes and other membrane proteins essential for cellular energy production and homeostasis .

How is the structural organization of YidC related to its function?

YidC's structure consists of five transmembrane (TM) segments that form a distinctive cavity within the lipid bilayer. This cavity is open to the lipidic phase and the cytoplasm but not to the extracytoplasmic environment . The five TM helices are arranged like the vertices of a pentagon in the order 4-5-3-2-6 (when viewed from the cytoplasm) .

A striking feature of YidC is that the concave surface of its cavity is enriched in hydrophilic amino acid residues, including a conserved arginine (Arg73 in SpoIIIJ homolog). This hydrophilic cavity plays a crucial role in facilitating membrane protein insertion by providing a favorable environment for substrate proteins to interact with before membrane integration . Outside the membrane region, YidC contains a cytoplasmic loop between TM2 and TM3 that forms a helical hairpin, referred to as the "helical paddle domain" (HPD), which interacts with lipid headgroups .

What is the current understanding of the molecular mechanism of YidC-mediated membrane insertion?

YidC facilitates membrane protein insertion through a channel-independent mechanism, which differs from traditional translocons. The hydrophilic cavity of YidC creates a microenvironment that attracts extracytoplasmic parts of substrate proteins through electrostatic interactions .

Research using the B. subtilis YidC homolog (SpoIIIJ) and its substrate (MifM) has revealed that the positive charge of the conserved arginine residue (Arg73) in the cavity and the negatively charged residues in the extracytoplasmic and TM regions of MifM are essential for insertion. This suggests an electrostatic attraction mechanism between YidC and its substrates .

The insertion process appears to involve multiple stages where the substrate protein first docks in the hydrophilic groove of YidC (initial phase) and then moves toward the periplasmic side (final phase). This process has been studied using both equilibrium and non-equilibrium molecular dynamics simulations to track conformational changes during insertion .

How does the hydrophilic cavity of YidC contribute to membrane protein insertion at the molecular level?

The cavity creates a unique amphiphilic environment that interfaces between the aqueous cytoplasm and the hydrophobic membrane interior. This arrangement allows YidC to act as a "proteinaceous amphiphile" that reduces the energy barrier for membrane proteins during their insertion process .

Critical to this function is the presence of an arginine residue (conserved across YidC family members) on the cavity surface. Interestingly, research has shown that this arginine can function from several alternative positions within the cavity, suggesting that its positive charge creates an electrostatic field that attracts negatively charged regions of substrate proteins . This electrostatic attraction appears to be the initial driving force that brings the extracytoplasmic domains of substrate proteins into the YidC cavity before they establish their transmembrane configuration through hydrophobic partitioning.

What key residues are essential for YidC function and how have they been identified?

Several critical residues have been identified as essential for YidC function through a combination of molecular dynamics simulations, evolutionary analysis, and in vivo complementation assays:

  • Conserved arginine residue (Arg73 in SpoIIIJ): This residue is crucial for creating the positive electrostatic environment needed for substrate attraction and proper insertion .

  • Stabilizing residues: Molecular dynamics simulations have identified T362 in TM2 and Y517 in TM6 as key stabilizing residues that, when mutated to alanine, completely inactivate YidC despite stable expression of the protein .

  • Additional functional residues: F433, M471, and F505 show intermediate activity levels when mutated, while residues further away from the core functional region have minimal effect on activity .

The identification of these essential residues has been accomplished through:

  • Evolutionary covariation analysis to predict contacts between residue pairs

  • Lipid-versus-protein exposure predictions to determine helix orientations

  • Molecular dynamics simulations to assess protein stability and residue interactions

  • In vivo complementation assays to verify the functional importance of specific residues

  • Photo-cross-linking experiments showing interactions between the inner surface of the cavity and substrate proteins

How do researchers experimentally differentiate between Sec-dependent and Sec-independent YidC pathways?

Differentiating between Sec-dependent and Sec-independent YidC pathways requires specific experimental approaches:

  • Substrate selection: Researchers use model substrates known to follow specific pathways. For example, small phage coat proteins like Pf3 and M13 are inserted via the Sec-independent YidC pathway .

  • Depletion studies: By creating conditional YidC depletion strains (such as E. coli strain JS7131, where yidC expression is controlled by the araBAD operator/promoter), researchers can observe the effects of YidC absence on different substrates .

  • Reconstitution experiments: In vitro reconstitution systems with purified components allow researchers to determine the minimal requirements for insertion of specific substrates.

  • Mutational analysis: Mutations in specific regions of YidC that selectively affect one pathway but not the other can help distinguish the pathways.

  • Crosslinking and structural studies: These techniques help visualize interactions between YidC and substrate proteins, as well as potential interactions with the Sec machinery in the Sec-dependent pathway.

The accumulated evidence from these approaches has firmly established that YidC functions both in conjunction with the Sec translocon and independently, with the pathway choice depending on the specific properties of the substrate protein.

What are the most effective experimental approaches for studying YidC-mediated membrane insertion?

Researchers employ several complementary approaches to study YidC function:

  • Molecular Dynamics (MD) Simulations: Both equilibrium and non-equilibrium MD simulations have proven effective for investigating YidC's insertion mechanism. Non-equilibrium targeted MD (TMD) as implemented in the colvars module of NAMD has been particularly useful for modeling the insertion process .

  • Evolutionary Covariation Analysis: This computational approach predicts contacts between pairs of residues based on evolutionary conservation patterns. It has been successfully used to build structural models of YidC by identifying helix-helix interactions .

  • In Vivo Complementation Assays: These assays test the functional significance of specific residues by creating alanine mutants and assessing their ability to rescue YidC-depleted cells .

  • Cryo-EM Analysis: This technique has been used to visualize YidC-ribosome nascent chain complexes, providing insights into the structural basis of co-translational membrane insertion .

  • Photo-Cross-linking Experiments: These have demonstrated that the inner surface of the YidC cavity interacts directly with substrate proteins during insertion .

  • Proton Motive Force (PMF) Measurements: These provide information about the bioenergetic consequences of YidC depletion on membrane protein insertion and respiratory chain assembly .

How can molecular dynamics simulations contribute to understanding YidC function?

Molecular dynamics (MD) simulations have become invaluable tools for understanding YidC function at the atomic level:

  • Structural Validation: MD simulations help validate structural models derived from evolutionary analysis by assessing their stability in a simulated membrane environment. For YidC, this confirmed the stability of the five-helix bundle arrangement and identified key stabilizing interactions .

  • Conformational Dynamics: Simulations reveal how YidC and its substrate proteins change conformation during the insertion process, capturing intermediate states that may be difficult to observe experimentally.

  • Water Accessibility: MD simulations can track water molecules within the YidC cavity, confirming the hydrophilic nature of this region that is critical for function .

  • Residue Interactions: Simulations provide detailed information about inter-residue interactions within the TM region, helping identify which residues stabilize interactions with lipid tails and which contribute to the integrity of the YidC core .

  • Insertion Pathway Modeling: Non-equilibrium targeted MD simulations have been used to model the transfer of substrate proteins (like Pf3 coat protein) from the initial docking position in YidC's hydrophilic groove to the periplasmic side of the membrane .

For effective MD simulations of YidC, researchers typically use:

  • NAMD software with the CHARMM36 force field for proteins and lipids

  • TIP3P model for water simulation

  • Mixed lipid compositions (such as 3 POPE to 1 POPG) to mimic bacterial membranes

  • Initial equilibration followed by production runs ranging from hundreds of nanoseconds to microseconds

What techniques are most effective for identifying and characterizing YidC substrates?

Researchers employ several complementary approaches to identify and characterize YidC substrates:

  • YidC Depletion Studies: Conditional YidC depletion strains (such as E. coli strain JS7131 with arabinose-controlled YidC expression) allow researchers to identify proteins whose membrane insertion is YidC-dependent by comparing protein levels and localization before and after depletion .

  • Crosslinking Approaches: Photo-crosslinking experiments can capture direct interactions between YidC and potential substrate proteins during the insertion process, confirming a direct role for YidC in their biogenesis .

  • Ribosome Nascent Chain Complexes: Reconstituting YidC with ribosome-nascent chain complexes (RNCs) and analyzing them by cryo-EM provides structural insights into co-translational insertion mediated by YidC .

  • In Vitro Translation-Insertion Assays: These assays use purified components to test whether specific proteins require YidC for proper membrane insertion and can distinguish between Sec-dependent and Sec-independent pathways.

  • Proteomics Approaches: Comparative proteomics of membrane fractions from YidC-depleted versus non-depleted cells can identify membrane proteins whose levels are reduced upon YidC depletion, suggesting they are YidC substrates.

  • Genetic Screening: Suppressor screens or synthetic lethal screens can identify genetic interactions that suggest functional relationships between YidC and potential substrate proteins.

What expression systems provide optimal yields of functional recombinant YidC for structural studies?

Though the search results don't specifically detail expression systems for recombinant Janthinobacterium sp. YidC, we can extrapolate from successful approaches used for other bacterial YidC homologs:

  • Expression Hosts: E. coli strains optimized for membrane protein expression, such as C43(DE3) or Lemo21(DE3), are often preferred as they can accommodate the potentially toxic effects of overexpressing membrane proteins.

  • Expression Vectors: Vectors with tightly controlled inducible promoters (such as the arabinose-inducible system mentioned in the search results ) allow for precise control of expression levels, which is critical for obtaining properly folded membrane proteins.

  • Purification Strategies: For functional studies, YidC is typically extracted from membranes using mild detergents that maintain its native structure and activity. His-tagged constructs facilitate purification by immobilized metal affinity chromatography (IMAC).

  • Functional Verification: The activity of purified YidC can be assessed through reconstitution experiments where it is incorporated into liposomes and tested for its ability to insert model substrate proteins.

  • Structural Studies: For high-resolution structural studies, YidC has been successfully studied using X-ray crystallography (as with B. halodurans YidC ) and cryo-EM in complex with ribosomes (as described in search result ).

When working specifically with Janthinobacterium sp. YidC, researchers would need to optimize these general approaches based on the specific properties of this homolog, potentially adapting expression conditions to account for the psychrotolerant nature of Janthinobacterium species.

How does YidC function differ across bacterial species, particularly in extremophiles like Janthinobacterium sp.?

While the search results don't provide specific information about Janthinobacterium sp. YidC, comparison across bacterial species reveals both conservation and specialization:

YidC homologs have been studied in various bacteria including E. coli, B. subtilis (SpoIIIJ and YidC2/YqjG), and B. halodurans . The core function of membrane protein insertion appears to be conserved, with a common structural feature being a hydrophilic cavity with a positively charged arginine residue .

Janthinobacterium sp. are psychrotolerant bacteria that can grow at low temperatures. Since membrane fluidity and protein folding dynamics are affected by temperature, it would be valuable to investigate how YidC in these bacteria might be adapted for function in cold environments. Potential adaptations could include:

  • Modified hydrophilic/hydrophobic balance in the cavity to compensate for temperature effects on membrane fluidity

  • Altered kinetics of substrate binding and release

  • Structural adaptations that maintain flexibility at lower temperatures

Future research comparing YidC function across species adapted to different environmental conditions could provide insights into the evolutionary adaptability of this essential membrane protein insertase.

What is the relationship between YidC and membrane protein quality control mechanisms?

The search results don't directly address this question, but it represents an important frontier in YidC research. As a membrane protein insertase, YidC likely interfaces with quality control mechanisms that ensure proper folding and assembly of membrane proteins.

Potential areas for investigation include:

  • Interaction between YidC and membrane-associated chaperones or proteases

  • Role of YidC in preventing misfolding or aggregation of membrane proteins

  • Mechanisms for directing incorrectly inserted proteins to degradation pathways

  • Stress response mechanisms that upregulate YidC function under conditions that challenge membrane protein homeostasis

Understanding these relationships would provide a more comprehensive picture of how cells maintain membrane proteostasis and could reveal new therapeutic targets for addressing diseases associated with membrane protein misfolding.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.