Recombinant Janthinobacterium sp. Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
kdpC; mma_1821; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Janthinobacterium sp. (strain Marseille) (Minibacterium massiliensis)
Target Names
kdpC
Target Protein Sequence
MKSTFRPALVIFAMLTLICGVIYPYAITGIGKLVFPGQAEGSLVTQNGAAVGSSLIGQAF TSPQYFWGRPSATGPMPNNASASGGSNLGPTNPALLDAVKGRIDALKAADPGNTAAVPVD LVTASGSGLDPEISVAAAYYQMPRVARERKMAVEEVKAMIDRISQPQYMGFFGENRVNVL TLNLALDQR
Uniprot No.

Target Background

Function
The recombinant Janthinobacterium sp. Potassium-transporting ATPase C chain (KdpC) is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. KdpC acts as a catalytic chaperone, enhancing the ATP-binding affinity of the ATPase subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.
Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the Janthinobacterium sp. KdpC and what is its role in bacterial physiology?

KdpC is a subunit of the KdpFABC complex, a high-affinity K+ pump that combines the ion channel KdpA and the P-type ATPase KdpB to secure bacterial survival under potassium-limited conditions . The protein is encoded by the kdpC gene and functions as part of this heteromeric membrane protein complex. While KdpB serves as the catalytic subunit that hydrolyzes ATP, and KdpA forms the K+ channel, KdpC has been suggested to influence substrate affinity . In Janthinobacterium sp., this system is crucial for adaptation to various environments, including high-altitude and cold habitats where nutrient availability may be limited .

How does the KdpFABC complex differ from other potassium transport systems in bacteria?

The KdpFABC complex represents a unique hybrid transport system that combines properties of both ion channels and P-type ATPases, distinguishing it from other bacterial potassium transporters. Unlike constitutively expressed low-affinity K+ transport systems, KdpFABC is specifically induced under potassium limitation and functions with remarkably high affinity (apparent K+ affinity of 2 μM) and substrate specificity . The complex operates through an intersubunit tunnel between KdpA and KdpB, with a constriction point controlled by a phenylalanine that regulates K+ entry via polarized cation-π stacking. Within the canonical substrate binding site (CBS) of KdpB, ATPase coupling is mediated by charge distribution between an aspartate and a lysine . This chimeric architecture makes KdpFABC unique among K+ transporters and suggests it might represent an early evolutionary form of cation pumps.

What methods are used to express and purify recombinant Janthinobacterium sp. KdpC?

Methodology for recombinant KdpC expression and purification:

  • Gene Cloning:

    • Amplify the kdpC gene from Janthinobacterium sp. genomic DNA using PCR with specific primers containing appropriate restriction sites

    • Clone the amplified fragment into an expression vector (e.g., pET series) with an affinity tag (His-tag)

  • Expression System:

    • Transform the recombinant plasmid into an E. coli expression strain (BL21(DE3) or similar)

    • Culture in a suitable medium (LB or defined medium) at optimal temperature (typically 25-30°C for membrane proteins)

    • Induce expression with IPTG at optimized concentration (0.1-1.0 mM) when culture reaches appropriate density (OD600 ~0.6-0.8)

  • Membrane Protein Extraction:

    • Harvest cells by centrifugation and resuspend in buffer containing protease inhibitors

    • Disrupt cells using techniques such as sonication or French press

    • Isolate membrane fraction through differential centrifugation

    • Solubilize membrane proteins using appropriate detergents (e.g., n-dodecyl-β-D-maltoside)

  • Purification:

    • Perform affinity chromatography (Ni-NTA for His-tagged proteins)

    • Further purify using size exclusion chromatography to remove contaminants and improve protein purity

    • Verify purity using SDS-PAGE and Western blotting

This approach can be adapted based on specific research needs and protein characteristics.

How can I measure the in vitro ATPase activity of the KdpFABC complex containing recombinant KdpC?

Detailed methodology for ATPase activity measurement:

  • Reagent Preparation:

    • Prepare assay buffer: 50 mM Tris-HCl (pH 7.5), 100 mM NaCl, 5 mM MgCl₂

    • Prepare ATP solution: 10 mM ATP in assay buffer

    • Prepare malachite green phosphate detection reagent or obtain commercial kit

  • Reaction Setup:

    • Combine purified KdpFABC complex (0.5-5 μM) with assay buffer

    • For stimulated activity, add cardiolipin or other acidic phospholipids if applicable

    • Pre-incubate at optimal temperature (25-37°C, depending on strain characteristics)

    • Initiate reaction by adding ATP (final concentration 1-5 mM)

  • Kinetic Measurement:

    • Remove aliquots (20-50 μL) at defined time intervals (0, 5, 10, 15, 30, 60 min)

    • Immediately quench reaction with malachite green reagent

    • Incubate for 20-30 minutes at room temperature

    • Measure absorbance at 620-640 nm

  • Data Analysis:

    • Convert absorbance values to phosphate concentration using a standard curve

    • Plot phosphate released versus time

    • Calculate rate of ATP hydrolysis from the slope of the linear regression

    • Express activity as nmol phosphate generated per minute per μM protein

  • Controls and Validation:

    • Include negative control (BSA or heat-inactivated protein)

    • Perform assays in technical duplicate/triplicate

    • For complete characterization, perform both endpoint assays (overnight) and kinetic assays (1-2 hours)

This protocol can detect ATPase activity with high sensitivity (~50 pmol phosphate in 100 μL) .

What genetic manipulation methods are effective for studying kdpC function in Janthinobacterium species?

Methodological approach to genetic manipulation:

  • Gene Deletion Strategy:

    • Construct a knockout vector containing:

      • Homologous regions (1,000 bp) upstream and downstream of kdpC

      • Kanamycin resistance cassette between homologous regions

      • Appropriate origin of replication

  • Vector Construction:

    • Amplify homologous regions using PCR with primers containing extensions complementary to the vector and resistance gene

    • Amplify kanamycin resistance gene from suitable source (e.g., pK19)

    • Assemble fragments with linearized vector using In-Fusion cloning or similar method

    • Transform into E. coli for vector propagation

    • Extract unmethylated plasmid from a methylase-deficient strain (e.g., E. coli ER2925)

  • Transformation Protocol:

    • Culture Janthinobacterium sp. to optimal density (OD600 ~0.4)

    • Harvest cells and wash with 300 mM sucrose

    • Mix competent cells with unmethylated plasmid DNA

    • Perform electroporation (2 mm cuvette, 2,500 V, 25 μF, 200 Ω)

    • Allow recovery in appropriate medium (e.g., CYM) at 23°C

    • Select transformants on medium containing kanamycin (50 μg/mL)

  • Verification of Mutants:

    • Screen colonies by PCR of relevant genomic regions

    • Compare amplicon sizes to wild-type controls

    • Confirm using sequencing

    • Validate phenotypic changes related to potassium transport

This methodology has been successfully applied for genetic manipulation of Janthinobacterium sp., though specific optimization may be required for different strains .

How do environmental factors influence KdpC expression and function in Janthinobacterium strains?

Janthinobacterium species inhabit diverse environments including glacial streams, permafrost regions, and high-altitude ecosystems . Research indicates that environmental adaptations significantly impact the expression and function of transport systems like KdpFABC:

  • Temperature Effects:

    • Cold adaptation in psychrotolerant Janthinobacterium strains involves modification of membrane composition and transport systems

    • Studies show that strains isolated from glacial environments express cold-adaptive properties, including modified ion transport mechanisms

    • Methodology to study temperature effects:

      • Cultivate cells at different temperatures (4°C, 15°C, 25°C)

      • Extract RNA at mid-logarithmic phase

      • Perform RT-qPCR targeting kdpC

      • Compare expression levels normalized to reference genes

  • Potassium Limitation Response:

    • KdpFABC expression is typically induced by K+ limitation

    • Methodology for studying K+ limitation response:

      • Cultivate cells in defined medium with varying K+ concentrations

      • Monitor growth rates and lag phases

      • Measure kdpC expression using RT-qPCR or reporter gene constructs

      • Perform proteomics to quantify KdpC protein levels

  • Genomic Adaptation Analysis:

    • Comparative genomics reveals insights into evolutionary adaptations

    • Data from genome sequencing of different strains (e.g., Janthinobacterium sp. PAMC 25724) allows identification of genetic determinants of cold-adaptive properties

    • Methodology for genomic analysis:

      • Perform whole-genome sequencing using combined approach with 454 GS FLX Titanium system and Illumina sequencing

      • Assemble using tools like Celera assembler

      • Annotate using platforms like RAST server and NCBI COG database

      • Compare kdp operons across strains using bioinformatic tools

These approaches can reveal how environmental adaptation shapes KdpC function and expression in different ecological niches.

What is the relationship between the KdpFABC system and violacein production in Janthinobacterium strains?

The relationship between the KdpFABC potassium transport system and violacein production in Janthinobacterium species represents an intriguing aspect of bacterial physiology and regulation:

  • Regulatory Connections:

    • While not directly linked, both systems respond to environmental stressors and may share regulatory elements

    • Comparative genomics of violacein-producing and non-producing strains reveals:

      • All Janthinobacterium strains are phylogenetically closely related

      • Non-violacein producing strains (like ERGS5:01) may still possess adaptation mechanisms for high-altitude environments

      • Violacein-producing strains often possess both N-acyl-homoserine lactone (AHL) QS and Janthinobacterium QS (JQS) systems

  • Methodological Approach to Study Connections:

    • Comparative analysis of gene expression:

      • Culture strains under varying potassium concentrations

      • Measure violacein production using spectrophotometric methods

      • Perform RNA-seq to identify co-regulated genes

      • Construct regulatory network models

  • Quorum Sensing Systems and Transport:

    • The AHL QS system may influence both violacein production and membrane protein expression

    • Experimental approach:

      • Generate QS system mutants (e.g., ΔjqsA) using methods described in search result

      • Compare KdpFABC expression and activity in wild-type and QS mutant strains

      • Test effects of spent media from QS-competent strains on KdpC expression

  • Environmental Adaptation Coordination:

    • Both systems may be part of a coordinated response to environmental challenges

    • Janthinobacterium strains from different environments (soil vs. subsurface) show variations in secondary metabolite production and transport systems

Understanding this relationship provides insights into how bacteria coordinate different aspects of their physiology in response to environmental challenges.

How can I analyze potential interactions between KdpC and other subunits of the KdpFABC complex?

Methodological approaches for analyzing protein-protein interactions:

  • Structural Analysis:

    • X-ray crystallography or cryo-EM studies of the complete KdpFABC complex

    • Methodology:

      • Express and purify complete KdpFABC complex

      • Perform crystallization trials or prepare cryo-EM grids

      • Collect and process diffraction data or cryo-EM images

      • Build and refine structural models

      • Identify interface residues between KdpC and other subunits

  • Mutational Analysis:

    • Site-directed mutagenesis of potential interaction sites

    • Experimental approach:

      • Identify conserved residues at subunit interfaces

      • Generate point mutations using PCR-based mutagenesis

      • Express and purify mutant complexes

      • Assess complex stability using size-exclusion chromatography

      • Measure ATPase activity to determine functional consequences

  • Computational Prediction:

    • In silico analysis of protein-protein interfaces

    • Methods:

      • Homology modeling based on related structures

      • Molecular dynamics simulations to study dynamic interactions

      • Prediction of binding energy contributions of specific residues

      • Construction of interaction networks based on conservation patterns

  • Crosslinking and Mass Spectrometry:

    • Chemical crosslinking followed by mass spectrometric analysis

    • Protocol:

      • Treat purified KdpFABC complex with crosslinking reagents

      • Digest crosslinked products with proteases

      • Analyze digested peptides by LC-MS/MS

      • Identify crosslinked peptides using specialized software

      • Map crosslinks to protein sequences to determine interaction sites

This multilayered approach can provide comprehensive insights into the structural basis of interactions within the KdpFABC complex.

How can I evaluate the quality of my experimental data when working with recombinant KdpC?

Methodological approach to data quality evaluation:

  • Systematic Quality Assessment Framework:

    • Define evaluation criteria specific to KdpC research

    • Implement quantitative scoring methods using matrices similar to those in search result

    • Apply the following evaluation methods:

  • Protein Quality Assessment:

    • Purity analysis:

      • Quantify band purity on SDS-PAGE using densitometry

      • Calculate percent purity relative to total protein

    • Functional verification:

      • Measure specific activity (μmol ATP hydrolyzed/min/mg protein)

      • Compare to published values for similar proteins

    • Structural integrity:

      • Perform circular dichroism to verify secondary structure

      • Use thermal shift assays to assess stability

  • Experimental Data Evaluation Matrix:

Evaluation CriterionScoring MethodAcceptance Threshold
Protein purityDensitometry (%)>95%
Batch-to-batch variationCoefficient of variation (%)<15%
ATPase activity reproducibilityStandard deviation of replicates<10%
Signal-to-noise ratioSignal/background>5:1
Standard curve linearityR² value>0.98
  • Statistical Approaches:

    • Apply appropriate statistical tests:

      • Use paired t-tests for before/after comparisons

      • Implement ANOVA for multi-condition experiments

      • Calculate confidence intervals for measurements

    • Visualization techniques:

      • Generate box plots to identify outliers

      • Use control charts to monitor process stability over time

This systematic approach to data quality evaluation helps ensure reliable and reproducible results in KdpC research .

What are the most common challenges in interpreting KdpFABC complex function data, and how can I address them?

Challenges and methodological solutions:

  • Challenge: Distinguishing Direct vs. Indirect Effects

    • Problem: Mutations in KdpC may affect complex assembly rather than direct function

    • Solution Methodology:

      • Perform size exclusion chromatography to verify complex integrity

      • Use blue native PAGE to assess complex formation

      • Implement thermal stability assays to detect destabilizing effects

      • Create control mutations outside functional sites but with similar structural impact

  • Challenge: Enzyme Kinetics Complexity in Multi-Enzyme Complexes

    • Problem: Traditional enzyme kinetics models may not fully capture the behavior of the KdpFABC complex

    • Solution Methodology:

      • Incorporate protease-as-substrate dynamics approaches (similar to cathepsin systems)

      • Build differential equation models accounting for:

        • Substrate-enzyme interactions

        • Conformational changes

        • Subunit interactions

      • Use systems of ordinary differential equations to model multiple species simultaneously

  • Challenge: Environmental Variable Control

    • Problem: KdpFABC activity is sensitive to experimental conditions

    • Solution Methodology:

      • Systematically vary buffer conditions:

        • Test multiple pH values (6.0-8.0)

        • Vary salt concentrations (50-200 mM)

        • Test different divalent cations (Mg²⁺, Ca²⁺, Mn²⁺)

      • Create a standardized assay environment based on optimization results

      • Include appropriate controls in each experiment

  • Challenge: Data Integration Across Different Experimental Approaches

    • Problem: Reconciling data from biochemical, genetic, and structural approaches

    • Solution Methodology:

      • Develop integrative models that incorporate:

        • Structural constraints from crystallography/cryo-EM

        • Biochemical data from activity assays

        • Genetic data from mutational analysis

      • Create weighted scoring systems that account for the reliability of different data types

      • Use Bayesian approaches to update models as new data becomes available

By systematically addressing these challenges, researchers can develop more robust interpretations of KdpFABC function.

How can I design experiments to investigate the ion transport mechanism through the KdpFABC complex?

Comprehensive experimental design methodology:

  • Transport Assay Development:

    • Reconstitution into liposomes:

      • Purify KdpFABC complex with recombinant KdpC

      • Prepare liposomes with defined lipid composition

      • Reconstitute complex using detergent removal methods

      • Verify orientation using protease protection assays

    • Measure potassium transport:

      • Use fluorescent potassium indicators (PBFI)

      • Alternatively, use radioactive ⁴²K⁺ for direct measurement

      • Monitor transport over time with varying ATP concentrations

      • Calculate initial rates for kinetic analysis

  • Structure-Function Analysis:

    • Site-directed mutagenesis of key residues:

      • Target the phenylalanine constriction point identified in the intersubunit tunnel

      • Mutate the aspartate-lysine pair in the canonical substrate binding site

      • Create charge-altering and conservative mutations

    • Analyze mutant proteins:

      • Compare transport rates

      • Measure ATPase activity using methodology from question 2.1

      • Determine ion selectivity by competition experiments

  • Conformational Change Monitoring:

    • Fluorescence-based approaches:

      • Introduce cysteine residues at strategic positions

      • Label with environment-sensitive fluorophores

      • Monitor fluorescence changes during transport cycle

    • EPR spectroscopy:

      • Introduce spin labels at key positions

      • Measure distances between labeled residues

      • Track conformational changes upon substrate binding

  • Computer Simulation Methodology:

    • Molecular dynamics (MD) simulations:

      • Build system based on available structural data

      • Embed complex in lipid bilayer with explicit solvent

      • Run extended simulations (>100 ns)

      • Analyze ion coordination, water molecules, and protein dynamics

    • Free energy calculations:

      • Compute potential of mean force for K⁺ transport

      • Identify energy barriers and binding sites

      • Compare wild-type and mutant systems

This comprehensive approach combines experimental and computational methods to elucidate the ion transport mechanism through the KdpFABC complex.

How does the KdpC from Janthinobacterium sp. compare with KdpC proteins from other bacterial species?

Methodological approach to comparative analysis:

  • Sequence Analysis Framework:

    • Multiple sequence alignment:

      • Collect KdpC sequences from diverse bacterial species

      • Align using MUSCLE or similar algorithms

      • Identify conserved motifs and variable regions

    • Phylogenetic analysis:

      • Construct phylogenetic trees using Maximum Likelihood methods

      • Calculate evolutionary distances

      • Correlate with bacterial taxonomy and habitat

  • Structural Comparison:

    • Homology modeling:

      • Generate structural models for KdpC proteins lacking experimental structures

      • Superimpose models to identify structural conservation

      • Calculate RMSD values to quantify structural differences

    • Conserved interaction analysis:

      • Identify residues involved in subunit interactions

      • Compare conservation patterns at interface regions

      • Assess correlation with functional differences

  • Functional Comparison Table:

SpeciesK⁺ Affinity (μM)Optimal pHTemperature RangeEnvironmental NicheUnique Features
Janthinobacterium sp.~2.06.5-7.04-25°CGlacial/alpine environmentsCold adaptation
E. coli~2.07.0-7.520-37°CIntestinal/freshwaterWell-characterized model
Pseudomonas sp.~1.56.5-7.515-30°CSoil/waterEnvironmental versatility
  • Gene Context Analysis:

    • Examine operon structure across species:

      • Identify regulatory elements

      • Compare gene order and conservation

      • Correlate with expression patterns

    • Investigate horizontal gene transfer:

      • Detect signatures of HGT events

      • Assess impact on functional adaptation

This comparative approach reveals how evolutionary pressures in different environments have shaped KdpC structure and function across bacterial species.

What can we learn about high-altitude and cold adaptation mechanisms by studying the KdpFABC system in Janthinobacterium?

Methodological framework for studying adaptation mechanisms:

  • Genomic Adaptation Analysis:

    • Comparative genomics approach:

      • Compare genomes of high-altitude/cold-adapted Janthinobacterium strains (e.g., ERGS5:01 from Sikkim Himalaya) with mesophilic relatives

      • Identify genomic signatures of adaptation

      • Focus on genes involved in ion homeostasis, including the kdp operon

    • Specific adaptations in high-altitude strains:

      • Genes associated with freezing tolerance

      • Mechanisms for survival during freeze-thaw cycles

      • Modifications to membrane composition and function

  • Functional Characterization:

    • Temperature-dependent activity profiling:

      • Purify KdpFABC complex from cold-adapted and mesophilic strains

      • Measure ATPase activity across temperature range (4-37°C)

      • Determine activation energy using Arrhenius plots

      • Compare thermal stability profiles

    • Membrane composition analysis:

      • Characterize lipid profiles using mass spectrometry

      • Correlate lipid changes with KdpFABC function

      • Reconstitute complex in liposomes with different lipid compositions

  • Expression Regulation Studies:

    • Temperature-responsive expression:

      • Culture bacteria at different temperatures

      • Quantify kdpC transcript levels using RT-qPCR

      • Perform RNA-seq to identify co-regulated genes

      • Map temperature-responsive regulatory elements

  • Physiological Integration Model:

    • Connect KdpFABC function to broader adaptation mechanisms:

      • Relate potassium transport to osmotic stress responses

      • Integrate with freeze protection mechanisms

      • Model energetic costs and benefits at low temperatures

    • Experimental validation:

      • Create knockout mutants

      • Test survival under freeze-thaw conditions

      • Measure intracellular K⁺ concentrations using atomic absorption spectroscopy

This framework enables researchers to understand how the KdpFABC system contributes to the remarkable ability of Janthinobacterium strains to thrive in extreme high-altitude and cold environments .

What role might the KdpFABC system play in the ecological interactions of Janthinobacterium strains?

Methodological approach to ecological interaction studies:

  • Microbial Community Analysis:

    • Field sampling methodology:

      • Collect samples from environments with Janthinobacterium presence

      • Extract environmental DNA

      • Perform 16S rRNA amplicon sequencing

      • Use metagenomic approaches to identify functional genes

    • Community composition correlation:

      • Associate Janthinobacterium abundance with environmental K⁺ levels

      • Identify potential competitor and cooperator species

      • Track seasonal variations in community structure

  • Competition Experiments:

    • Laboratory microcosm studies:

      • Establish defined mixed cultures with potential competitors

      • Vary potassium availability to create limitation conditions

      • Monitor population dynamics using species-specific qPCR

      • Measure kdp operon expression in response to competition

  • Host-Microbe Interaction Studies:

    • Amphibian skin microbiome research:

      • Janthinobacterium strains show potential for inhibiting amphibian pathogens

      • Methodology to examine role of KdpFABC:

        • Compare wild-type and kdp mutant colonization efficiency

        • Assess potassium limitation in host-associated environments

        • Measure competitive fitness advantage conferred by high-affinity K⁺ uptake

  • Biofilm Formation Analysis:

    • Biofilm development under K⁺ limitation:

      • Grow biofilms in flow cells with controlled K⁺ concentrations

      • Visualize using confocal microscopy

      • Quantify biomass, thickness, and architecture

      • Compare wild-type and kdp mutant biofilm characteristics

These methodological approaches can reveal how the high-affinity potassium transport system contributes to ecological fitness and interactions in natural environments.

How might structural information about KdpC contribute to the design of antimicrobial compounds targeting the KdpFABC complex?

Methodological framework for structure-based drug design:

  • Target Validation Approach:

    • Essentiality assessment:

      • Create conditional kdpC mutants in model pathogens

      • Test survival under K⁺ limitation conditions

      • Determine minimum inhibitory concentrations of K⁺

      • Evaluate fitness costs of kdpC deletion in infection models

    • Selectivity evaluation:

      • Compare bacterial and human K⁺ transport systems

      • Identify structural differences for selective targeting

      • Assess potential for cross-reactivity

  • Structural Analysis for Drug Design:

    • Binding site identification:

      • Use computational approaches to identify druggable pockets

      • Focus on species-specific regions and subunit interfaces

      • Analyze conservation patterns to target essential regions

    • Structure determination methods:

      • X-ray crystallography or cryo-EM of KdpFABC complex

      • NMR studies of isolated KdpC domain interactions

      • Computational modeling of protein dynamics

  • Compound Screening Strategy:

    • Virtual screening methodology:

      • Develop pharmacophore models based on structural features

      • Perform molecular docking against identified binding sites

      • Score compounds based on predicted binding energy

      • Filter for drug-like properties (Lipinski's rules)

    • Experimental validation:

      • Test top candidates for binding using biophysical methods (SPR, ITC)

      • Measure inhibition of ATPase activity using established assays

      • Evaluate antimicrobial activity in K⁺-limited conditions

  • Resistance Development Assessment:

    • Resistance emergence studies:

      • Perform serial passage experiments with sub-lethal inhibitor concentrations

      • Sequence kdp operon from resistant isolates

      • Introduce identified mutations using site-directed mutagenesis

      • Test effect on inhibitor binding and activity

This framework provides a systematic approach to exploring the potential of KdpC as a novel antimicrobial target, leveraging structural information to design selective inhibitors of this essential potassium transport system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.