Recombinant Janthinobacterium sp. Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Enzyme Overview

Biological Role:

  • Lgt is the first enzyme in the bacterial lipoprotein biosynthesis pathway, initiating lipid anchoring of prolipoproteins .

  • Essential for Gram-negative bacterial survival; deletion of lgt is lethal in many species .

Recombinant Production:

  • Derived from Janthinobacterium sp. (strain Marseille), with recombinant expression in E. coli .

  • Uniprot ID: A6SVP3 .

Applications and Research Implications

Biochemical Research:

  • Tool for studying lipoprotein biosynthesis in Janthinobacterium sp., a violacein-producing genus .

  • Potential use in inhibitor screening to target bacterial lipoprotein pathways .

Pathogenicity Studies:

  • Lipoproteins influence host immune responses (e.g., TLR2 activation) .

  • Janthinobacterium lividum is an emerging pathogen in aquatic systems ; understanding Lgt could elucidate virulence mechanisms.

Knowledge Gaps and Future Directions

  • Structural Data: No crystal structures for Janthinobacterium sp. Lgt are available. Homology modeling using E. coli Lgt (PDB: 4W4F) may provide insights .

  • Functional Studies: Activity assays specific to the recombinant enzyme are lacking.

  • Therapeutic Potential: Lgt is a validated drug target in Mycobacterium tuberculosis ; its role in Janthinobacterium sp. pathogenicity warrants exploration .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement in the order notes. We will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery timelines, please contact your local distributors.
Note: All protein shipments include standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us and we will prioritize development accordingly.
Synonyms
lgt; mma_0650; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Janthinobacterium sp. (strain Marseille) (Minibacterium massiliensis)
Target Names
lgt
Target Protein Sequence
MWIHPMPDPVALSIGPLAIRWYGLMYLAAFAQFIWLARIRIKQPHIARAGWKKEDIDDML FYGVLGVIIGGRLGEVLFYDPSYYFSNPLEIFKVWKGGMSFHGGFLGVLLAMSIWARRQG RNVLDVWDFIAPMVPLGYAFGRLGNFINAELPGRIADASLPWAMIWPNVDNLPRHPSPLY QALVDGLLMFILLWLFARKERPRMAVGGMFALLYGSARFFTEYFRMPDYEVHFAGITISA GQMLSVPLIVLGIVMLLIAYRKKPA
Uniprot No.

Target Background

Function
Recombinant Janthinobacterium sp. Prolipoprotein diacylglyceryl transferase (lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, the first step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (Lgt) and what is its role in bacterial physiology?

Prolipoprotein diacylglyceryl transferase (Lgt) is an essential membrane-bound enzyme that catalyzes the first step in bacterial lipoprotein biogenesis. It specifically transfers a diacylglyceryl moiety from phosphatidylglycerol to a conserved cysteine residue in prolipoprotein substrates, forming a thioether bond that anchors lipoproteins to the bacterial membrane . This modification is crucial for proper lipoprotein processing and localization.

In Gram-negative bacteria like E. coli and Janthinobacterium sp., Lgt plays a vital role in maintaining outer membrane integrity. Research demonstrates that Lgt depletion in uropathogenic E. coli leads to permeabilization of the outer membrane, making bacteria more susceptible to serum killing and antibiotics . Importantly, bacterial lipoproteins modified by Lgt contribute to diverse essential cellular functions, including nutrient acquisition, stress responses, and pathogenesis.

The enzyme's central role in bacterial physiology makes it an attractive target for novel antibacterial development, as inhibition of Lgt activity leads to multiple deleterious effects on bacterial survival and virulence .

What is the biochemical mechanism of the reaction catalyzed by Lgt?

Lgt catalyzes a complex transesterification reaction that transfers a diacylglyceryl moiety from phosphatidylglycerol to a conserved cysteine residue in prolipoprotein substrates. The reaction proceeds through several distinct steps that can be systematically characterized:

  • Binding of phosphatidylglycerol substrate to the Lgt active site

  • Recognition and binding of the prolipoprotein substrate, specifically at the conserved cysteine residue

  • Nucleophilic attack by the cysteine thiol group on the phosphatidylglycerol

  • Formation of a thioether bond between the cysteine and the diacylglyceryl moiety

  • Release of glycerol phosphate as a byproduct

This reaction can be monitored in vitro by measuring the release of glycerol phosphate. Since commercial phosphatidylglycerol typically contains a racemic glycerol moiety, both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) can be released during the reaction . For experimental purposes, the detection of these byproducts, particularly G3P, can be achieved using coupled enzyme assays with luciferase for quantitative measurement of Lgt activity.

For substrate specificity, Lgt recognizes the lipobox motif (often L-A-A-C) within prolipoproteins, with the conserved cysteine being essential for modification. Research has shown that mutation of this cysteine (e.g., to alanine) prevents Lgt-mediated modification .

How can researchers effectively measure Lgt enzymatic activity in vitro?

Measuring Lgt enzymatic activity in vitro is essential for characterizing the enzyme's properties and evaluating potential inhibitors. Based on established research protocols, the following methodological approach is recommended:

Principle of the Assay:
The assay detects glycerol phosphate released as Lgt catalyzes the transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate. This release serves as a quantitative measure of Lgt activity .

Materials Required:

  • Purified recombinant Lgt

  • Phosphatidylglycerol substrate

  • Synthetic peptide substrate (e.g., Pal-IAAC, derived from Pal lipoprotein)

  • Appropriate buffer system (typically pH 7.4-8.0)

  • Detection system for glycerol phosphate

Assay Protocol:

  • Prepare reaction mixtures containing Lgt, phosphatidylglycerol, and peptide substrate in buffer

  • Include appropriate controls:

    • Negative control: Reaction mixture without Lgt

    • Substrate specificity control: Using mutated peptide (e.g., Pal-IAAA, with cysteine replaced by alanine)

  • Incubate reactions at optimal temperature (typically 30-37°C)

  • Terminate reactions at defined time points

  • Quantify glycerol phosphate release

Detection Methods:
A coupled enzyme assay is commonly employed, utilizing glycerol-3-phosphate (G3P) oxidase and peroxidase, which can be further coupled to luciferase for enhanced sensitivity . Alternatively, radiometric assays using radiolabeled phosphatidylglycerol or mass spectrometry to directly detect modified peptide products can be utilized.

For inhibitor studies, researchers have successfully used these methods to calculate IC50 values, such as those reported for Lgt inhibitors G9066, G2823, and G2824 (0.24 μM, 0.93 μM, and 0.18 μM, respectively) .

What methods are used for expression and purification of recombinant Janthinobacterium sp. Lgt?

Expression and purification of recombinant Janthinobacterium sp. Lgt present unique challenges due to its membrane-bound nature. The following methodological approach addresses these challenges:

Expression System Selection:

  • E. coli-based expression systems (BL21(DE3), C41(DE3), or C43(DE3) strains) are commonly used for membrane protein expression

  • Vectors with tightly regulated promoters (T7, tac) help control expression levels

  • Fusion tags (His6, MBP, or GST) improve solubility and facilitate purification

Expression Optimization:

  • Lower induction temperatures (16-25°C) improve proper folding of membrane proteins

  • Reduced inducer concentrations minimize toxicity and aggregation

  • Addition of specific lipids or detergents to the growth medium can enhance proper membrane integration

Membrane Protein Extraction:

  • Cell disruption by sonication, French press, or enzymatic methods

  • Membrane fraction isolation by differential centrifugation

  • Solubilization using mild detergents (DDM, LDAO, or Triton X-100)

  • Selective extraction to separate inner and outer membrane proteins if needed

Purification Strategy:

  • Affinity chromatography using the fusion tag (IMAC for His-tagged proteins)

  • Ion exchange chromatography for further purification

  • Size exclusion chromatography for final polishing and detergent exchange

Storage and Stability:
For recombinant Janthinobacterium sp. Lgt specifically, storage in Tris-based buffer with 50% glycerol at -20°C or -80°C is recommended for extended storage . Working aliquots should be kept at 4°C for up to one week, with repeated freeze-thaw cycles avoided to maintain protein functionality .

The purified protein should undergo quality assessment through SDS-PAGE, Western blotting, circular dichroism, and activity assays to confirm structural integrity and functional activity before use in downstream applications.

How can researchers detect and characterize different lipoprotein forms in bacterial lysates?

Detecting and characterizing different lipoprotein forms is crucial for understanding lipoprotein processing and validating Lgt inhibition. A comprehensive methodological approach includes:

SDS-PAGE and Western Blot Analysis:

  • Sample Preparation:

    • Separate bacterial lysates into subcellular fractions:

      • Total cell lysate

      • SDS-soluble fraction (non-peptidoglycan-associated proteins)

      • SDS-insoluble fraction (peptidoglycan-associated proteins)

    • Use lysozyme treatment to release peptidoglycan-linked forms

  • Western Blotting:

    • Use antibodies specific to the lipoprotein of interest (e.g., anti-Lpp)

    • Optimize transfer conditions for small, hydrophobic proteins

  • Identification of Different Forms:
    Different forms can be identified by their migration patterns:

    • Unmodified prolipoprotein (UPLP): Fastest migration

    • Diacylglyceryl-modified prolipoprotein (DGPLP): Intermediate migration

    • Triacylated mature form: Slowest migration

    • Peptidoglycan-linked forms: Additional higher molecular weight bands

Triton X-114 Phase Separation:
This technique separates proteins based on their hydrophobicity:

  • Amphiphilic proteins (lipid-modified) partition into the detergent phase

  • Hydrophilic proteins (unmodified) remain in the aqueous phase

Flow Cytometry and Microscopy:

  • Use fluorescently labeled antibodies against surface lipoproteins

  • Compare signal intensities between wild-type and Δlgt mutants

  • Visualize lipoprotein localization using immunofluorescence microscopy

For example, research with E. coli successfully used SDS fractionation to separate peptidoglycan-associated proteins (PAP) and non-peptidoglycan-associated proteins (non-PAP), identifying different Lpp forms through Western blotting . This approach revealed that depletion of Lgt led to accumulation of unmodified pro-Lpp, while depletion of LspA (lipoprotein signal peptidase) led to accumulation of diacylglyceryl-modified pro-Lpp and other peptidoglycan-linked forms .

What phenotypic changes occur in bacterial cells following Lgt deletion or inhibition?

Lgt deletion or inhibition leads to multiple phenotypic changes in bacterial cells, reflecting the essential role of lipoproteins in various cellular functions. Based on research with E. coli and S. pneumoniae, the following significant changes have been documented:

Membrane Structure and Integrity:

  • Permeabilization of the outer membrane

  • Reduced cell envelope stiffness

  • Altered peptidoglycan-membrane linkages

  • Accumulation of unmodified prolipoprotein (UPLP)

Antibiotic Susceptibility:

  • Increased sensitivity to serum killing

  • Enhanced susceptibility to various antibiotics

  • Greater vulnerability to lysozyme

Cation Homeostasis:

  • Reduced cation acquisition capacity

  • Decreased intracellular levels of several cations

  • Diminished zinc uptake specifically

  • Impaired growth in cation-depleted media

Metabolic Effects:

  • Increased doubling time when utilizing specific carbon sources (glucose, raffinose, maltotriose)

  • Altered ABC transporter functions affecting nutrient uptake

Virulence Impairment:

  • Reduced growth in blood or bronchoalveolar lavage fluid

  • Markedly impaired virulence in mouse models of:

    • Nasopharyngeal colonization

    • Sepsis

    • Pneumonia

Lipoprotein Processing:

  • Disruption of downstream lipoprotein processing steps

  • Altered lipoprotein localization

  • Changes in peptidoglycan crosslinking

How does Lgt contribute to bacterial membrane integrity?

Lgt plays a critical role in maintaining bacterial membrane integrity through its essential function in lipoprotein biogenesis. By catalyzing the attachment of diacylglyceryl to prolipoproteins, Lgt enables the proper anchoring of numerous lipoproteins to the bacterial membrane. These lipoproteins serve diverse functions related to membrane stability and cellular homeostasis.

Research with E. coli demonstrates that Lgt depletion leads to significant permeabilization of the outer membrane, resulting in increased sensitivity to serum killing and antibiotics . Similarly, in S. pneumoniae, deletion of the lgt gene results in reduced lipoprotein expression on the cell surface and compromised membrane function .

The major outer membrane lipoprotein Lpp (also known as Braun's lipoprotein in E. coli) is particularly important for cell envelope stiffness and stability. Lpp forms crosslinks between the outer membrane and the peptidoglycan layer, contributing to cellular integrity . Detailed biochemical studies have revealed that efficient crosslinking of Lpp to peptidoglycan appears to require prior diacylglyceryl modification by Lgt.

An interesting observation from research is that unlike other enzymes in the lipoprotein biosynthesis pathway, deletion of lpp is not sufficient to rescue growth after Lgt depletion or provide resistance to Lgt inhibitors . This suggests that multiple Lgt-modified lipoproteins collectively contribute to membrane integrity, beyond the role of Lpp alone.

How does Lgt inhibition affect bacterial susceptibility to other antimicrobial agents?

Lgt inhibition significantly alters bacterial susceptibility to other antimicrobial agents, creating opportunities for combination therapies and potentially overcoming resistance mechanisms. This enhanced susceptibility stems from fundamental changes in membrane structure and function:

Enhanced Susceptibility Profile:

  • Beta-lactams: Lgt depletion increases susceptibility to various beta-lactams due to compromised cell envelope integrity

  • Membrane-Active Agents: Markedly increased sensitivity to polymyxins and antimicrobial peptides

  • Serum and Complement: Enhanced killing by serum components, particularly relevant for bloodstream infections

  • Aminoglycosides: Potentially improved uptake due to membrane permeabilization

Mechanisms Underlying Enhanced Susceptibility:

  • Outer Membrane Permeabilization:
    Research with E. coli demonstrates that Lgt depletion leads to permeabilization of the outer membrane, allowing greater access of antibiotics to their targets . This is particularly significant for hydrophobic antibiotics that normally struggle to penetrate the gram-negative outer membrane.

  • Altered ABC Transporter Function:
    Studies with S. pneumoniae show that Δlgt mutants have impaired ABC transporter functions, affecting not only nutrient acquisition but potentially also drug efflux systems . This may contribute to increased intracellular accumulation of antibiotics.

  • Compromised Stress Responses:
    Lgt deletion results in increased sensitivity to oxidative stress and reduced ability to adapt to environmental challenges . This may impair the activation of stress-induced resistance mechanisms that normally protect bacteria during antibiotic exposure.

These findings suggest significant potential for Lgt inhibitors in combination therapy strategies, particularly against multidrug-resistant gram-negative pathogens where outer membrane permeability is a significant barrier to antibiotic efficacy. The distinct mechanism of action of Lgt inhibitors complements traditional antibiotics, potentially allowing for enhanced killing and reduced development of resistance.

How does Lgt inhibition differ from inhibition of other enzymes in the lipoprotein biosynthesis pathway?

Lgt inhibition offers distinct advantages over targeting other enzymes in the lipoprotein biosynthesis pathway, particularly regarding resistance mechanisms:

Unique Resistance Profile:

  • Deletion of lpp (major outer membrane lipoprotein) is a common resistance mechanism that invalidates inhibitors of downstream steps in lipoprotein biosynthesis

  • For example, lpp deletion provides resistance to globomycin, which inhibits LspA (lipoprotein signal peptidase)

  • Critically, lpp deletion is NOT sufficient to rescue growth after Lgt depletion

  • Research demonstrates that lpp deletion does NOT provide resistance to Lgt inhibitors

  • Surprisingly, data indicates that Lpp is actually protective in cells treated with Lgt inhibitors

Molecular Basis for This Difference:
The mechanistic explanation for this unique characteristic lies in the sequence of lipoprotein processing:

  • Lgt catalyzes the first step in lipoprotein biosynthesis (diacylglyceryl modification)

  • Efficient crosslinking of Lpp to peptidoglycan requires prior diacylglyceryl modification

  • In the absence of this modification, peptidoglycan-linked Lpp forms are significantly reduced

  • Consequently, targeting Lgt overcomes a major liability of targeting other steps in the pathway

Resistance Development Challenge:
Researchers have been unable to raise on-target resistant mutants to Lgt inhibitors . This is consistent with the hypothesis that mutations disrupting inhibitor binding might also disrupt essential Lgt function, leading to cell death. Similar resistance profiles have been observed with globomycin, which binds to a highly conserved active site.

This resistance profile makes Lgt an especially attractive antibacterial target, as it appears less vulnerable to common resistance mechanisms affecting other lipoprotein biosynthesis inhibitors. The fact that inhibition of Lgt affects multiple lipoproteins beyond Lpp contributes to this robust antibacterial activity.

What experimental approaches can be used to validate Lgt as an antibacterial target?

Validating Lgt as an antibacterial target requires a multi-faceted experimental approach that demonstrates its essentiality, druggability, and potential therapeutic window. Based on research literature, the following methodological strategies are recommended:

1. Genetic Validation:

  • Create conditional knockout strains (e.g., inducible deletion mutants)

  • Assess growth and viability upon Lgt depletion

  • Evaluate phenotypes in various growth conditions

  • Compare phenotypes across multiple bacterial species

2. Chemical Validation:

  • Identify small molecule inhibitors through binding screens or high-throughput screening

  • Confirm on-target activity using biochemical assays (e.g., measuring glycerol phosphate release)

  • Evaluate structure-activity relationships

  • Assess bactericidal activity against wild-type strains

3. Mechanism of Action Validation:

  • Monitor accumulation of unmodified prolipoproteins by Western blot

  • Use SDS fractionation to separate peptidoglycan-associated proteins

  • Compare phenotypes of inhibitor treatment with genetic deletion

  • Assess effects on downstream lipoprotein processing

4. Resistance Profiling:

  • Attempt to generate resistant mutants through serial passage

  • Evaluate cross-resistance with other antibiotics

  • Test activity against strains with common resistance mechanisms

  • Determine if lpp deletion provides protection against Lgt inhibition

5. In Vivo Efficacy:

  • Evaluate activity in relevant infection models

  • Compare virulence of wild-type vs. Lgt-depleted strains

  • Assess efficacy in different infection types (colonization, sepsis, pneumonia)

  • Determine minimum effective doses and therapeutic window

Research with E. coli has successfully validated Lgt as an antibacterial target using several of these approaches, including identification of inhibitors (G9066, G2823, G2824) with potent activity against the enzyme and bactericidal activity against wild-type strains . Similarly, studies with S. pneumoniae demonstrated that Δlgt mutants had markedly impaired virulence in multiple infection models, supporting the potential therapeutic relevance of Lgt inhibition .

What is the relationship between Lgt activity and bacterial virulence in different infection models?

The relationship between Lgt activity and bacterial virulence has been extensively studied across different infection models, revealing its critical importance in pathogenesis. Research with S. pneumoniae and E. coli provides compelling evidence for this relationship:

S. pneumoniae Infection Models:

Studies with S. pneumoniae Δlgt mutants demonstrated profound virulence attenuation across multiple infection models:

  • Nasopharyngeal Colonization:

    • Δlgt mutants showed markedly reduced colonization capacity

    • Impaired adherence to nasopharyngeal epithelial cells

  • Pneumonia Model:

    • Significantly attenuated virulence in lung infection

    • Reduced bacterial burden in lung tissue

    • Improved survival of infected animals

  • Sepsis Model:

    • Severely impaired ability to establish bloodstream infection

    • Reduced survival in blood

    • Decreased bacterial burden in systemic organs

E. coli Infection Models:

In uropathogenic E. coli (UPEC), Lgt depletion led to:

  • Increased sensitivity to serum killing

  • Reduced survival in infection models

  • Compromised ability to establish infection

Mechanisms Linking Lgt to Virulence:

Several interconnected mechanisms explain how Lgt activity contributes to bacterial virulence:

  • Nutrient Acquisition:

    • Multiple lipoproteins function in various ABC transporters

    • Δlgt mutants show reduced cation uptake, particularly zinc

    • Impaired acquisition of essential nutrients in host environments

  • Stress Resistance:

    • Reduced resistance to oxidative stress

    • Impaired adaptation to host environment

    • Compromised survival under nutrient limitation

  • Growth in Host Fluids:

    • Δlgt mutants show significantly reduced growth in:

      • Blood

      • Bronchoalveolar lavage fluid

      • Serum

    • These defects directly impact in vivo fitness

The multiple defects in cation and sugar ABC transporter function observed in Δlgt mutants collectively prevent these bacteria from establishing invasive infection . This widespread impact on virulence across different pathogens and infection models validates Lgt as a promising antibacterial target with potential applications against multiple bacterial pathogens.

How can researchers design effective Lgt inhibitors based on structure-activity relationships?

Designing effective Lgt inhibitors requires systematic exploration of structure-activity relationships (SAR) guided by understanding of the enzyme's structure and mechanism. While detailed structural information on Lgt-inhibitor complexes is limited, the following methodological approach can guide inhibitor development:

Target Site Identification:

  • Focus on the conserved phosphatidylglycerol binding site

  • Consider the prolipoprotein substrate binding region

  • Evaluate active site residues based on homology models or available structural data

  • Analyze potential allosteric sites for non-competitive inhibition

Initial Scaffold Identification:
Several approaches can be used to identify promising starting points:

  • High-throughput screening of diverse compound libraries

  • Fragment-based approaches to identify binding motifs

  • Virtual screening based on homology models

Structure-Activity Relationship Development:
Systematic modification of lead compounds should focus on:

  • Lipophilicity (to enable membrane penetration)

  • Hydrogen bond donors/acceptors

  • Charge and polarity

  • Molecular size and flexibility

These modifications should be correlated with:

  • Biochemical inhibition potency (IC50 values)

  • Bacterial growth inhibition (MIC values)

  • Cytotoxicity against mammalian cells

Optimization Strategies:
Due to the membrane-associated nature of Lgt, effective inhibitors likely require specific physicochemical properties:

  • Enhanced membrane penetration for access to the periplasmic/membrane space

  • Balanced hydrophobicity for membrane association without aggregation

  • Reduced efflux susceptibility

Validation Experiments:

  • Confirm mechanism of action through biochemical assays measuring glycerol phosphate release

  • Verify on-target activity via accumulation of unmodified prolipoproteins

  • Test against multiple bacterial species to assess spectrum of activity

The research with E. coli has identified several potent Lgt inhibitors (G9066, G2823, G2824) with IC50 values in the submicromolar range (0.24 μM, 0.93 μM, and 0.18 μM, respectively) . Analysis of these compounds and their structure-activity relationships could provide valuable insights for further development of improved Lgt inhibitors.

What are the comparative effects of Lgt deletion across different bacterial species?

Lgt deletion produces both conserved and species-specific effects across different bacterial species, reflecting the essential but varied roles of lipoproteins in bacterial physiology. A comparative analysis based on research with E. coli, S. pneumoniae, and related studies reveals important patterns:

Conserved Effects Across Species:

  • Lipoprotein Processing:

    • Accumulation of unmodified prolipoproteins

    • Reduced lipoprotein anchoring to membranes

    • Altered lipoprotein localization

  • Membrane Integrity:

    • Compromised membrane structure

    • Increased membrane permeability

    • Enhanced sensitivity to membrane-active agents

  • Virulence:

    • Attenuated pathogenicity in infection models

    • Reduced survival in host environments

Species-Specific Differences:

FeatureE. coli (Gram-negative)S. pneumoniae (Gram-positive)
Growth defectsSevere in minimal mediaSlight delay in complete media
Membrane effectsOuter membrane permeabilization Altered surface properties
Antibiotic sensitivityIncreased for multiple classes Enhanced serum killing
Cation homeostasisAltered metal ion transportReduced zinc uptake specifically
Carbon source utilizationVariable impactIncreased doubling time with glucose, raffinose, maltotriose
Oxidative stressModerate sensitivityMarkedly increased sensitivity
Virulence impactReduced pathogenicitySeverely impaired in multiple infection models
Lpp-related phenotypesLpp deletion not protective N/A (no direct Lpp homolog)

Methodological Implications:

These comparative differences highlight the importance of species-specific validation when targeting Lgt for antimicrobial development. Researchers should consider:

  • Testing Lgt inhibitors against a panel of relevant pathogens

  • Evaluating species-specific pharmacodynamics

  • Considering combination therapy approaches based on species-specific vulnerabilities

The differences between gram-positive and gram-negative bacteria are particularly notable, likely reflecting their distinct cell envelope architectures and the different roles that lipoproteins play in each. Nevertheless, the conserved essentiality of Lgt across diverse bacterial species supports its potential as a broad-spectrum antibacterial target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.