Recombinant Janthinobacterium sp. Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Biosynthesis and Production

The recombinant protein is synthesized via the following steps:

  1. Gene Cloning: The htpX gene (locus: mma_1278) is cloned into a plasmid vector under a strong promoter .

  2. Expression: Host E. coli cells are induced to produce the protein, which accumulates in inclusion bodies due to membrane localization .

  3. Purification: Denaturing conditions (e.g., urea) solubilize the protein, followed by refolding in zinc-chelator buffers to restore activity .

  4. Storage: Lyophilized or stored at -20°C/-80°C in glycerol-containing buffers to prevent aggregation .

Proteolytic Activity

  • Substrate Specificity: Degrades casein and membrane proteins like SecY in E. coli, confirming zinc-dependent endoprotease activity .

  • Quality Control: Collaborates with ATP-dependent proteases (e.g., FtsH) to maintain membrane protein integrity under stress .

Biological Roles in Host Organisms

  • Antibiotic Resistance: In Stenotrophomonas maltophilia, HtpX synergizes with ClpA to mitigate aminoglycoside-induced stress, making it a potential drug target .

  • Quorum Sensing: In Janthinobacterium sp. HH01, HtpX homologs are linked to violacein production via the jqsA-mediated signaling pathway .

Key Studies

  1. Aminoglycoside Resistance

    • Deletion of htpX in S. maltophilia reduced aminoglycoside MICs by 2- to 16-fold, highlighting its role in intrinsic antibiotic resistance .

    • Table 1: Impact of htpX Deletion on Antibiotic Susceptibility

      StrainAmikacin MIC (µg/mL)Gentamicin MIC (µg/mL)
      Wild-Type6432
      ΔhtpX168
      ΔclpAΔhtpX42
  2. Violacein Biosynthesis

    • Janthinobacterium sp. HH01 uses HtpX homologs in a jqsA-dependent regulatory circuit to modulate violacein, a bioactive pigment with antimicrobial properties .

Applications and Future Directions

  • Biotechnological Tools: Used in in vivo protease activity assays to study membrane protein degradation .

  • Therapeutic Targets: Potential adjuvant target for aminoglycoside-resistant infections .

  • Industrial Enzymes: Engineered variants could optimize protein quality control in bioreactors .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for prioritized development.
Synonyms
htpX; mma_1278; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Janthinobacterium sp. (strain Marseille) (Minibacterium massiliensis)
Target Names
htpX
Target Protein Sequence
MKRIFLFIATNIAVIAVMSVVLSLLGVDRFISQAGLNLPMLLVFSLVVGFTGSIISLLIS KPMAKWSTGARVIDAPSSSTELWLIDTVSKLAQRAGIKMPEVAVYDGEPNAFATGAFRDS ALVAVSTGLLQSMTKDEVEAVLAHEVAHVANGDMVTMTLVQGVVNTFVVFLSRVVGYFVD RAISRDNNNSQGIGYTITVIVSQIVFGIAASVIVAWFSRHREFRADAGAAKLLGSPQPMM KALARLGGIEPTSLPEGLASLGINDKPGFAALFSSHPPIEDRIAALRSLQ
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Janthinobacterium sp. Protease HtpX homolog?

The Janthinobacterium sp. Protease HtpX homolog is a membrane-associated metalloproteinase characterized by a 290-amino acid sequence. Its UniProt accession number is A6SXH1, and its gene is encoded at the locus mma_1278. The full-length sequence includes transmembrane regions that anchor the protein in the cytoplasmic membrane, resembling the architecture seen in similar proteases like those in E. coli . The protein contains conserved zinc-binding motifs characteristic of M48 family zinc metalloproteinases, which are essential for its catalytic function . Understanding this structure provides the foundation for exploring its functional mechanisms in cellular contexts.

How does HtpX protease function in bacterial membrane protein quality control?

HtpX proteases function as integral components of membrane protein quality control systems by recognizing and eliminating misfolded or misassembled membrane proteins that could potentially compromise membrane integrity. Based on studies of HtpX in E. coli, which is homologous to the Janthinobacterium sp. version, these proteases cleave damaged or non-functional membrane proteins, preventing their accumulation and subsequent disruption of normal cellular activities . The proteolytic activity is zinc-dependent, targeting specific peptide bonds within substrate proteins. This quality control mechanism is particularly important during stress conditions when protein misfolding events increase, helping to maintain proper membrane function and cellular homeostasis.

What are the conserved domains in HtpX proteases across different bacterial species?

HtpX proteases across bacterial species, including Janthinobacterium sp., share several highly conserved domains that are critical for their function. The most notable conserved feature is the HEXXH zinc-binding motif, which coordinates the catalytic zinc ion essential for proteolytic activity. Additionally, these proteases typically contain four hydrophobic regions (H1-H4) that can serve as transmembrane segments, though the membrane topology may vary between species . Comparative analyses show that the catalytic domain is highly conserved among bacterial HtpX homologs, while the C-terminal regions display more variability, potentially reflecting species-specific adaptations to different membrane environments or substrate preferences.

What is the most effective expression system for producing recombinant Janthinobacterium sp. HtpX protease?

For effective expression of recombinant Janthinobacterium sp. HtpX protease, an E. coli-based expression system with careful consideration of membrane protein handling is recommended. Since HtpX is a membrane-associated protease, using an E. coli strain designed for membrane protein expression, such as C41(DE3) or C43(DE3), can significantly improve yield and solubility. The expression construct should include a fusion tag (His-tag or His-Myc tag) for purification purposes, similar to the "HtpX-HM" (HtpX-His6-Myc) or "HtpX-H10" (HtpX-His10) constructs used in E. coli HtpX studies .

The expression protocol should include:

  • Induction at lower temperatures (16-20°C) to minimize inclusion body formation

  • Use of mild detergents for extraction (e.g., n-dodecyl β-D-maltoside)

  • Purification under native conditions to maintain proteolytic activity

  • Storage in buffer containing 50% glycerol at -20°C to preserve activity

This approach maximizes the likelihood of obtaining functionally active recombinant protease suitable for subsequent biochemical and functional analyses.

How can researchers develop an in vivo protease activity assay for HtpX homologs?

Developing an in vivo protease activity assay for HtpX homologs requires the creation of a model substrate that can be efficiently cleaved by the protease and allows for sensitive detection of this cleavage. Based on methodology established for E. coli HtpX, researchers should:

  • Design a chimeric protein substrate (similar to the XMS1 construct for E. coli HtpX) containing:

    • A transmembrane segment recognized by HtpX

    • A reporter tag (such as monomeric superfolder GFP) for visualization

    • A detection tag (such as His or Myc) for immunoblotting

  • Express this model substrate in cells with and without active HtpX protease

  • Analyze substrate cleavage through:

    • Western blotting to detect full-length substrate (XMS1-FL) and cleaved fragments

    • Quantification of fragment-to-substrate ratio for semiquantitative assessment of proteolytic activity

  • Validate the system by testing HtpX variants with mutations in conserved residues to confirm specificity

This approach enables researchers to assess HtpX activity under various conditions and to evaluate the effects of mutations on protease function in a cellular context.

What are the optimal storage conditions for maintaining the stability of recombinant HtpX protease?

To maintain optimal stability and activity of recombinant Janthinobacterium sp. Protease HtpX homolog, specific storage conditions are essential. The recommended protocol includes:

  • Primary storage: Store the purified protein at -20°C in a Tris-based buffer containing 50% glycerol, which has been optimized specifically for this protein .

  • For extended storage periods: Maintain the protein at -80°C in single-use aliquots to prevent repeated freeze-thaw cycles, which can significantly decrease enzymatic activity.

  • Working solutions: Store working aliquots at 4°C for no longer than one week to maintain optimal activity .

  • Avoid repeated freezing and thawing: This is explicitly not recommended as it can lead to protein denaturation and loss of proteolytic activity .

  • Buffer additives: Consider including stabilizing agents such as zinc ions (required for metalloprotease activity) and reducing agents (if cysteine residues are present) in the storage buffer.

Following these guidelines will help preserve the structural integrity and enzymatic activity of the recombinant protease for experimental applications.

How does expression of HtpX proteases change under stress conditions in bacteria?

Expression of HtpX proteases exhibits significant regulation under various stress conditions, reflecting their role in cellular stress response mechanisms. In Pyrococcus furiosus, increased HtpX transcript levels have been observed during heat shock conditions, suggesting thermal stress induces HtpX expression . Similarly, in Haloferax volcanii, HtpX protein abundance increases during oxidative stress, indicating a role in managing oxidatively damaged membrane proteins .

In bacteria like Janthinobacterium sp., which inhabits diverse environments including extreme conditions, HtpX likely serves as a stress-responsive protease. The regulatory mechanisms may involve specific stress-response transcription factors that recognize promoter elements upstream of the htpX gene. This stress-induced expression pattern aligns with the proposed function of HtpX in quality control of membrane proteins, as stress conditions typically increase the burden of misfolded membrane proteins requiring proteolytic processing.

Research methodologies to investigate stress-dependent expression include:

  • qRT-PCR analysis of htpX expression under different stress conditions

  • Proteomic quantification of HtpX abundance after stress exposure

  • Reporter gene assays using the htpX promoter region to monitor transcriptional regulation

What is the relationship between HtpX proteases and biofilm formation in Janthinobacterium sp.?

The relationship between HtpX proteases and biofilm formation in Janthinobacterium sp. represents an intriguing area of research intersecting proteolytic quality control and bacterial community behavior. Janthinobacterium sp. is known for its strong biofilm-forming capacity, which involves floc formation and production of exopolysaccharides . While direct evidence linking HtpX to biofilm formation is limited, several mechanistic connections can be proposed:

  • Membrane protein quality control: HtpX may regulate the integrity of membrane proteins involved in biofilm formation pathways, including those responsible for exopolysaccharide production and export.

  • Stress response coordination: Since biofilm formation is often a stress response, the stress-responsive nature of HtpX expression may align with biofilm induction pathways.

  • Proteolytic processing of signaling proteins: HtpX might process membrane-associated signaling proteins that regulate biofilm formation genes.

Researchers investigating this relationship should consider employing:

  • Comparative biofilm assays using wild-type and htpX-deficient Janthinobacterium strains

  • Proteomic analysis of membrane proteins in biofilms with variable HtpX expression

  • Transcriptomic studies to identify overlap between HtpX-dependent and biofilm-related gene networks

How does the Type VI Secretion System interact with HtpX function in Janthinobacterium sp.?

The potential interaction between the Type VI Secretion System (T6SS) and HtpX function in Janthinobacterium sp. represents an advanced research question at the intersection of bacterial virulence and membrane protein homeostasis. Janthinobacterium sp. strain SLB01 possesses genes encoding the T6SS, which is considered a virulence factor in many Proteobacteria . While direct functional interactions between T6SS and HtpX have not been explicitly characterized, several hypothetical mechanisms can guide research in this area:

  • Membrane integrity maintenance: HtpX may contribute to the proper functioning of T6SS by ensuring quality control of membrane-associated T6SS components.

  • Stress response coordination: Both systems may be co-regulated under stress conditions, with HtpX potentially processing misfolded proteins resulting from T6SS assembly or operation.

  • Proteolytic processing of effectors: HtpX might process certain T6SS effector proteins either for activation or degradation.

Research approaches to investigate this interaction should include:

  • Comparative proteomics of T6SS components in wild-type versus htpX-deficient strains

  • Co-immunoprecipitation studies to identify physical interactions between HtpX and T6SS components

  • Functional assays measuring T6SS activity with varying levels of HtpX expression

How do archaeal HtpX homologs differ from bacterial counterparts in structure and function?

Archaeal HtpX homologs share fundamental similarities with their bacterial counterparts but exhibit notable differences in structural features and potentially in functional mechanisms. In Haloferax volcanii, three HtpX homologs have been identified (HVO_0102, HVO_2904, and HVO_A0045), suggesting diversification of function within archaeal systems . These archaeal homologs maintain the core catalytic domain characteristic of M48 family zinc metalloproteinases but may display variations in membrane topology and regulatory domains.

Key comparative aspects include:

  • Structural adaptations: Archaeal HtpX proteins likely contain adaptations to function in archaeal membranes, which differ in composition from bacterial membranes (containing unique archaeal lipids).

  • Regulatory mechanisms: In H. volcanii, the HtpX homolog HVO_A0045 shows increased abundance in strains lacking the rhomboid protease RhoII, suggesting regulatory interactions between different membrane proteases that may be unique to archaeal systems .

  • Functional redundancy: The presence of multiple HtpX homologs in archaeal genomes, compared to typically fewer in bacteria, suggests potential functional specialization or condition-specific roles.

Methodological approaches for comparative studies include:

  • Structural prediction and modeling of archaeal versus bacterial HtpX proteins

  • Heterologous expression studies to test functional complementation

  • Evolutionary analysis of HtpX protein sequences across domains of life

What is the evolutionary relationship between E. coli HtpX and Janthinobacterium sp. HtpX homolog?

The evolutionary relationship between E. coli HtpX and Janthinobacterium sp. HtpX homolog reflects the divergence and conservation patterns within the M48 family of zinc metalloproteinases across different bacterial lineages. While both belong to the same protein family and share conserved catalytic domains, they have evolved in distinct bacterial contexts.

Key aspects of their evolutionary relationship include:

  • Sequence conservation: The proteins share conserved catalytic motifs, particularly the HEXXH zinc-binding domain essential for metalloprotease activity.

  • Taxonomic distance: E. coli (Gammaproteobacteria) and Janthinobacterium sp. (Betaproteobacteria) represent different classes within Proteobacteria, suggesting divergence from a common ancestral HtpX gene.

  • Functional adaptation: Differences in sequence and structure likely reflect adaptations to the specific membrane environments and substrate preferences of each organism.

To investigate this evolutionary relationship, researchers should employ:

  • Phylogenetic analysis of HtpX sequences across diverse bacterial taxa

  • Comparative structural modeling to identify conserved and divergent regions

  • Functional complementation studies to test interchangeability of the proteases

How does the HtpX model substrate approach developed for E. coli apply to studying Janthinobacterium sp. HtpX?

The HtpX model substrate approach developed for E. coli provides a valuable methodological framework that can be adapted for studying the Janthinobacterium sp. HtpX homolog, with specific modifications to account for differences between the two proteases. The E. coli system utilized a construct called XMS1 (HtpX Model Substrate 1) that enabled semiquantitative assessment of protease activity in vivo .

For adaptation to Janthinobacterium sp. HtpX research, the following considerations and modifications are recommended:

  • Substrate design modifications:

    • Adjust transmembrane segments to match Janthinobacterium sp. membrane thickness and composition

    • Consider incorporating known or predicted Janthinobacterium sp. membrane protein sequences as cleavage sites

  • Expression system adaptation:

    • Develop both homologous (Janthinobacterium-based) and heterologous (E. coli-based) expression systems

    • Optimize expression conditions for the psychrotolerant nature of Janthinobacterium

  • Detection system refinements:

    • Maintain the dual-tag approach (N-terminal and C-terminal tags) for detecting cleavage products

    • Consider fluorescent protein tags optimized for function at lower temperatures

  • Validation steps:

    • Test substrate cleavage by both E. coli HtpX and Janthinobacterium sp. HtpX for comparative analysis

    • Create conserved residue mutations in Janthinobacterium sp. HtpX to confirm specificity

This adapted approach would facilitate comparative studies of protease activity across species and provide insights into the substrate specificity and regulatory mechanisms of the Janthinobacterium sp. HtpX homolog.

Key Properties of Janthinobacterium sp. Protease HtpX homolog (htpX)

PropertyDescriptionReference
UniProt IDA6SXH1
Gene NamehtpX
Locus Namemma_1278
Protein Length290 amino acids
Enzyme ClassificationEC 3.4.24.- (Metalloendopeptidases)
Storage Recommendation-20°C in Tris-based buffer with 50% glycerol
Extended Storage-20°C to -80°C
Working Storage4°C for up to one week
Bacterial SourceJanthinobacterium sp. (strain Marseille)
Proposed FunctionMembrane protein quality control
Related SystemsType VI Secretion System, biofilm formation

Comparison of HtpX Regulation Across Species

The regulation of HtpX proteases shows interesting patterns across different microbial species, reflecting their roles in stress response and membrane protein quality control:

SpeciesRegulatory ConditionExpression ChangeProposed FunctionReference
Pyrococcus furiosusHeat shockIncreased transcript levelsThermal stress response
Haloferax volcaniiOxidative stressIncreased protein abundanceManagement of oxidatively damaged membrane proteins
H. volcanii (ΔRhoII strain)Absence of rhomboid proteaseIncreased abundance of HVO_A0045 (HtpX homolog)Compensatory membrane protein quality control
E. coliHeat shockIncreased expressionProteolytic quality control of cytoplasmic membrane proteins
Janthinobacterium sp.Unknown (likely stress conditions)Not specifically determinedPredicted membrane protein quality control

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.