Recombinant Kalanchoe daigremontiana V-type proton ATPase 16 kDa proteolipid subunit

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Functional Role

The Recombinant Kalanchoe daigremontiana V-type proton ATPase 16 kDa proteolipid subunit is a key component of the V0_0 sector of V-ATPase, a multi-subunit enzyme critical for acidifying intracellular compartments like vacuoles, endosomes, and lysosomes. In plants, V-ATPases maintain cytosolic pH homeostasis, energize secondary transport processes, and support stress adaptation .

  • Biological Function:

    • Forms the proton-conducting pore within the V0_0 complex.

    • Enables ATP hydrolysis-driven proton translocation, essential for organelle acidification .

    • Participates in stomatal regulation, cell expansion, and ion sequestration .

Primary Structure

PropertyDetails
Amino Acid SequenceMSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG...AGQSRAD
Molecular Weight~16 kDa
Post-Translational ModificationsNone reported (produced in E. coli with His-tag)

Secondary and Tertiary Structure

  • Contains four transmembrane helices (predicted via UniProt) .

  • Forms a proteolipid ring with other subunits (e.g., VHA-c, VHA-c'') to create the proton channel .

Expression and Purification

ParameterDetails
Expression HostEscherichia coli (E. coli)
TagN-terminal His-tag for affinity purification
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose; -20°C/-80°C

Mechanistic Studies

  • Proton Transport Mechanisms: Used to dissect the role of proteolipid subunits in V0_0 assembly and proton channel gating .

  • pH Regulation: Investigates acidification dynamics in plant vacuoles under abiotic stress .

Comparative Analyses

  • Evolutionary Conservation: Comparisons with yeast and mammalian V-ATPases reveal plant-specific adaptations .

Functional Insights

  • Loss of V-ATPase activity in plants disrupts vacuolar morphology and ion transport, highlighting this subunit’s necessity .

  • The proteolipid ring’s architecture (e.g., subunit stoichiometry) is critical for proton translocation efficiency .

Stress Response

  • V-ATPase activity, mediated by this subunit, enhances salt tolerance and drought resistance in plants .

Future Research Directions

  1. Structural Flexibility: Elucidate conformational changes during proton transport.

  2. Stress Adaptation: Engineer V-ATPase variants to improve crop resilience.

  3. Interaction Networks: Map binding partners in the TGN/endosomal system .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
V-type proton ATPase 16 kDa proteolipid subunit; V-ATPase 16 kDa proteolipid subunit; V-type H(+-ATPase 16 kDa subunit; Vacuolar proton pump 16 kDa proteolipid subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Kalanchoe daigremontiana (Devil's backbone) (Bryophyllum daigremontianum)
Target Protein Sequence
MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG VRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAD
Uniprot No.

Target Background

Function
Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. It is essential for the crassulacean acid metabolism.
Protein Families
V-ATPase proteolipid subunit family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.
Tissue Specificity
Higher expression in leaves, followed by roots and weakly in flowers. Expression in leaves is light-dependent.

Q&A

What alternative names are used for this protein in the scientific literature?

The protein is formally known as V-type proton ATPase 16 kDa proteolipid subunit (full name) or V-ATPase 16 kDa proteolipid subunit (short name). Alternative nomenclature includes V-type H(+)-ATPase 16 kDa subunit and Vacuolar proton pump 16 kDa proteolipid subunit. These various designations appear across different publications and databases depending on the research context and focus .

What is the functional role of the V-type proton ATPase in Kalanchoe daigremontiana?

The V-type proton ATPase in Kalanchoe daigremontiana functions as a proton pump that generates electrochemical gradients across cellular membranes, particularly in the vacuolar (tonoplast) system. This protein complex plays crucial roles in cellular pH homeostasis, energizing secondary transport systems, and maintaining cellular ion balance. The 16 kDa proteolipid subunit specifically forms part of the membrane-embedded V0 domain that facilitates proton translocation across the membrane .

How can V-ATPase activity be reliably measured in plant tissue extracts?

V-ATPase activity in plant tissue extracts can be quantified through several complementary approaches:

  • Bafilomycin A1-sensitive ATPase activity measurements: This method utilizes the specific V-ATPase inhibitor Bafilomycin A1 to determine the proportion of total ATPase activity attributable to V-ATPases. The difference between total ATP hydrolysis and hydrolysis in the presence of the inhibitor represents V-ATPase activity.

  • Immunoprecipitation with specific antisera: As demonstrated with antisera against the catalytic V-ATPase subunit A, researchers can isolate intact V-ATPase complexes from tonoplast-enriched vesicles. The specific ATP-hydrolysis activity can then be determined based on the amount of V-ATPase solubilized and immunoprecipitated .

  • Silver staining and Western blot analysis: These techniques allow for visualization and semi-quantitative analysis of specific V-ATPase subunits, including the 16 kDa proteolipid subunit, following separation by SDS-PAGE .

What are the optimal storage conditions for preserving recombinant V-type proton ATPase activity?

For optimal preservation of recombinant V-type proton ATPase activity, the following storage conditions are recommended:

  • Store the protein at -20°C for routine use, and at -80°C for extended storage periods.

  • Use a Tris-based buffer supplemented with 50% glycerol, specifically optimized for this protein.

  • Avoid repeated freeze-thaw cycles as they can significantly compromise protein structure and activity.

  • For working solutions required within a short timeframe (up to one week), store aliquots at 4°C.

  • Consider adding protease inhibitors to prevent degradation by endogenous proteases when working with crude extracts .

What immunological approaches are most effective for studying V-ATPase subunits across different plant species?

Based on comparative immunological studies, several approaches have proven effective:

  • Multi-antisera approach: Using multiple antisera raised against different V-ATPase preparations provides complementary information. For example, antisera ATP88 and ATP95 raised against the V-ATPase holoenzyme of Kalanchoe daigremontiana showed differential cross-reactivity patterns with V-ATPases from other plant species, revealing structural variations not detectable with a single antiserum.

  • Subunit-specific antisera: Antisera raised against individual subunits (such as the catalytic subunit A from Mesembryanthemum crystallinum) can be used to immunoprecipitate the entire V-ATPase complex for further analysis.

  • Sequential immunological analysis: Combining immunoprecipitation with Western blot analysis using different antisera allows for detailed characterization of structural similarities and differences among V-ATPases from diverse plant species .

How does the V-type proton ATPase from Kalanchoe daigremontiana compare structurally to those from other plant species?

Structural comparisons of V-type proton ATPases across plant species reveal both conserved elements and species-specific variations:

  • Core structural conservation: Subunits A, B, C, D, and c (including the 16 kDa proteolipid subunit) are present in V-ATPases across diverse plant species, indicating evolutionary conservation of the fundamental complex architecture. The antiserum ATP88 recognized these core subunits in all tested plant species, including Kalanchoe blossfeldiana, Mesembryanthemum crystallinum, Nicotiana tabacum, Lycopersicon esculentum, Citrus limon, Lemna gibba, Hordeum vulgare, and Zea mays.

  • Structural variations: The differential cross-reactivity patterns observed with the ATP95 antiserum, which only recognized the complete set of subunits in K. blossfeldiana, M. crystallinum, H. vulgare, and Z. mays, indicate structural differences in certain V-ATPase subunits across species. These variations likely reflect adaptations to different physiological requirements or environmental conditions.

  • Functional correlations: Importantly, structural differences correlate with functional variations. V-ATPases showing full cross-reactivity with ATP95 demonstrated higher rates of specific ATP hydrolysis compared to those containing subunits not recognized by ATP95, suggesting that structural characteristics influence enzymatic efficiency .

What evolutionary insights can be gained from studying V-ATPase proteolipid subunits across different species?

Evolutionary analysis of V-ATPase proteolipid subunits across species provides several important insights:

  • Structural conservation amidst diversity: The presence of recognizable V-ATPase proteolipid subunits across diverse plant species points to an ancient evolutionary origin and functional importance that has been maintained through selective pressure.

  • Structure-function relationships: The correlation between structural characteristics (as revealed by immunological cross-reactivity) and ATP hydrolysis rates suggests that even subtle evolutionary changes in protein structure can significantly impact enzymatic function. V-ATPases with similar structural features (recognized by the same antisera) tend to exhibit comparable enzymatic properties.

  • Adaptive specialization: The variations in V-ATPase structure across plant species likely reflect evolutionary adaptations to different cellular environments, metabolic requirements, or ecological niches. Plants with unique physiological adaptations, such as the CAM photosynthesis pathway in Kalanchoe species, may have evolved specialized V-ATPase variants to support their distinctive cellular processes .

How can recombinant V-type proton ATPase be used to study cellular energy coupling mechanisms?

Recombinant V-type proton ATPase provides a powerful tool for investigating cellular energy coupling mechanisms through several experimental approaches:

  • Reconstitution studies: Purified recombinant V-ATPase can be incorporated into artificial membrane systems (liposomes) to study proton translocation and ATP hydrolysis under controlled conditions. By manipulating buffer composition, membrane potential, and proton gradients, researchers can quantify energy coupling ratios (protons translocated per ATP hydrolyzed).

  • Structure-function analyses: Site-directed mutagenesis of specific residues in the recombinant 16 kDa proteolipid subunit allows for detailed investigation of how amino acid changes affect proton translocation, ATP hydrolysis, and the coupling between these processes.

  • Inhibitor studies: The effects of specific inhibitors (like Bafilomycin A1) on recombinant V-ATPase activity provide insights into the mechanisms of energy coupling and the structural elements critical for enzyme function .

  • Interaction with regulatory proteins: Recombinant V-ATPase can be used to identify and characterize protein-protein interactions that regulate enzyme activity and coupling efficiency in response to cellular energy status or environmental conditions.

What is the relationship between V-ATPase structure and specific ATP-hydrolysis activity across different plant species?

Research comparing V-ATPases from multiple plant species has revealed important correlations between structural characteristics and enzymatic activity:

  • Structural determinants of activity: V-ATPases showing cross-reactivity of subunits A, B, C, D, and c with the ATP95 antiserum (including those from K. blossfeldiana, M. crystallinum, H. vulgare, and Z. mays) demonstrated higher rates of specific ATP hydrolysis compared to V-ATPases containing subunits not recognized by ATP95.

  • Activity variation: Under standardized assay conditions, specific ATP-hydrolysis activity varied significantly among V-ATPases from different plant species. This variation was directly correlated with structural differences as detected by differential immunological cross-reactivity.

  • Functional implications: V-ATPases with high turnover rates appear to share common structural characteristics that distinguish them from those with lower turnover rates. These structural features likely affect the catalytic mechanism, subunit interactions, or regulatory properties of the enzyme complex .

How does the proteolipid subunit contribute to proton transport and ATP hydrolysis coupling?

The 16 kDa proteolipid subunit plays a critical role in the function of V-type proton ATPases through several mechanisms:

What are the main challenges in expressing and purifying active recombinant V-type proton ATPase proteolipid subunits?

Several challenges must be addressed when expressing and purifying active recombinant V-type proton ATPase proteolipid subunits:

  • Membrane protein expression: As integral membrane proteins, proteolipid subunits are highly hydrophobic and often difficult to express in soluble form. Expression systems like E. coli may require optimization of codon usage, induction conditions, and the addition of solubilizing agents or fusion tags.

  • Proper folding: Ensuring correct folding of the proteolipid subunit in heterologous expression systems is challenging. The use of specialized E. coli strains, molecular chaperones, or alternative expression hosts may improve folding efficiency.

  • Complex assembly: The proteolipid subunit functions as part of a multi-subunit complex. Expressing the isolated subunit may not reflect its native structure or activity. Co-expression with interacting partners or reconstitution experiments may be necessary.

  • Purification without denaturation: Traditional purification methods may disrupt the native structure of membrane proteins. Detergent selection is critical, and approaches like affinity chromatography with carefully positioned tags (e.g., His-tags) can improve yields of properly folded protein .

  • Activity preservation: Maintaining activity during purification and storage requires careful optimization of buffer conditions, including pH, ionic strength, and glycerol concentration. The recommended storage in Tris-based buffer with 50% glycerol helps preserve structure and function .

How can researchers overcome the challenges of studying cross-species variations in V-ATPase structure and function?

Researchers can address challenges in studying cross-species variations in V-ATPase through several methodological approaches:

  • Multi-antisera strategy: Employing multiple antisera raised against different V-ATPase preparations or specific subunits provides complementary information. As demonstrated with ATP88 and ATP95 antisera, this approach can reveal structural differences not detectable with a single antiserum.

  • Standardized isolation procedures: Using consistent protocols for isolating tonoplast-enriched vesicles and solubilizing V-ATPases across different species enables reliable comparative analyses. The immunoprecipitation approach with an antiserum against the catalytic V-ATPase subunit A has proven effective for isolating V-ATPases from diverse plant species.

  • Calibrated activity assays: Implementing standardized conditions for measuring Bafilomycin A1-sensitive ATPase activity, while acknowledging that optimal assay conditions may vary across species, allows for meaningful comparisons of enzymatic properties.

  • Combined structural and functional analyses: Integrating immunological characterization, enzyme activity measurements, and when possible, structural biology approaches provides a more comprehensive understanding of structure-function relationships across species .

What potential applications exist for V-type ATPases in studying therapeutic compounds from Kalanchoe daigremontiana?

The study of V-type ATPases opens several promising avenues for investigating therapeutic compounds from Kalanchoe daigremontiana:

  • Cancer therapy targets: Research has shown that water extracts of Kalanchoe daigremontiana exhibit anticancer activity against ovarian cancer SKOV-3 cells, decreasing cell viability to approximately 38-53% at concentrations of 20-200 μg/mL. Understanding how these extracts interact with cellular proton pumps, including V-type ATPases which are often dysregulated in cancer cells, could reveal novel therapeutic mechanisms.

  • Cell death pathway analysis: Studies indicate that Kalanchoe daigremontiana extracts induce non-apoptotic cell death, as evidenced by the lack of caspase-3, 7, 8, and 9 activation in treated cancer cells. The role of V-type ATPases in this process, potentially through altered pH homeostasis or disruption of autophagy, represents an important research direction.

  • Oxidative stress modulation: Kalanchoe daigremontiana extracts have been shown to moderately increase ROS production in cancer cells while potentially having antioxidant effects in normal cells. V-type ATPases, which help maintain cellular pH and can influence redox status, may be involved in this dual activity .

How might emerging structural biology techniques advance our understanding of V-ATPase proteolipid subunits?

Recent advances in structural biology offer powerful new approaches to study V-ATPase proteolipid subunits:

  • Cryo-electron microscopy: This technique can provide high-resolution structures of entire V-ATPase complexes without the need for crystallization, revealing how the proteolipid subunits assemble into functional rings and interact with other components of the complex.

  • Hydrogen-deuterium exchange mass spectrometry: This approach can map protein-protein interaction surfaces and conformational changes in the proteolipid subunits during the catalytic cycle, providing insights into the dynamic aspects of V-ATPase function.

  • Molecular dynamics simulations: Computational approaches can model how the proteolipid ring facilitates proton transport at the atomic level, complementing experimental structural data with dynamic information about proton pathways and energy coupling mechanisms.

  • Cross-linking mass spectrometry: This technique can capture transient interactions between proteolipid subunits and other V-ATPase components, helping to elucidate the assembly process and regulatory mechanisms of the complex.

What is the role of V-ATPase in the medicinal properties of Kalanchoe daigremontiana extracts?

The relationship between V-ATPase activity and the medicinal properties of Kalanchoe daigremontiana extracts presents an intriguing research area:

  • Bufadienolide interactions: Phytochemical analysis of Kalanchoe daigremontiana water extracts has identified twenty steroidal compounds, including bufadienolide, bersaldegenin, daigremontianin, daigredorigenin, and daigremonate derivatives. These compounds may interact with V-ATPases, potentially affecting their proton pumping activity and cellular pH regulation.

  • Cellular energy disruption: Kalanchoe extracts decrease mitochondrial membrane potential in cancer cells, which may be linked to altered V-ATPase activity. The interplay between mitochondrial function, cellular energy status, and V-ATPase-mediated pH regulation could be central to the extract's anticancer effects.

  • Cell-specific responses: The differential effects of Kalanchoe extracts on cancer cells versus normal cells suggest selective targeting mechanisms. V-ATPases are often overexpressed or mislocalized in cancer cells, potentially explaining the selective toxicity of these plant compounds .

What are the best practices for designing experiments to study V-ATPase function in different subcellular compartments?

When investigating V-ATPase function across different subcellular compartments, researchers should consider the following methodological approaches:

  • Subcellular fractionation: Implementing differential and density gradient centrifugation techniques optimized for isolating specific membrane fractions (tonoplast, Golgi, endosomes, etc.) allows compartment-specific analysis of V-ATPase distribution and activity.

  • Marker enzyme assays: Using established marker enzymes for different organelles helps verify the purity of membrane fractions and accurately attribute V-ATPase activity to specific compartments.

  • Compartment-specific inhibitors: Employing inhibitors with differential effects on V-ATPases in different locations (e.g., concanamycin A shows some selectivity between vacuolar and Golgi V-ATPases) can distinguish compartment-specific functions.

  • Fluorescent pH indicators: Utilizing organelle-targeted pH-sensitive fluorescent proteins or dyes enables real-time monitoring of V-ATPase-dependent proton pumping in intact cells, providing functional data with subcellular resolution.

  • Immunolocalization: Combining subunit-specific antibodies (like those against the 16 kDa proteolipid subunit) with confocal microscopy allows visualization of V-ATPase distribution across cellular compartments .

How can researchers effectively analyze the impact of post-translational modifications on V-ATPase activity?

Analyzing post-translational modifications (PTMs) of V-ATPases requires a multi-faceted approach:

  • Mass spectrometry-based proteomics: Techniques like LC-MS/MS following enrichment for specific modifications (phosphorylation, glycosylation, etc.) can identify PTM sites on V-ATPase subunits, including the 16 kDa proteolipid subunit.

  • Site-directed mutagenesis: Generating recombinant proteins with mutations at potential modification sites (modifying specific amino acids to either prevent or mimic particular PTMs) helps establish the functional significance of these modifications.

  • Activity correlation studies: Comparing the PTM profile of V-ATPases with their enzymatic activity under different physiological conditions can reveal regulatory patterns. For instance, correlating phosphorylation states with changes in ATP hydrolysis or proton pumping efficiency.

  • Modification-specific antibodies: Developing antibodies that recognize specific PTMs on V-ATPase subunits enables monitoring of modification dynamics in response to cellular signals or environmental changes.

  • In vitro modification systems: Reconstituting V-ATPase modification in vitro using purified kinases, glycosyltransferases, or other modifying enzymes allows controlled analysis of how specific PTMs affect enzyme structure and function.

What are the most promising directions for future research on plant V-type proton ATPases?

Several promising directions for future V-type proton ATPase research include:

  • Structural biology advancements: Obtaining high-resolution structures of plant V-ATPases in different conformational states would significantly advance our understanding of how these enzymes couple ATP hydrolysis to proton transport. The 16 kDa proteolipid subunit, with its central role in proton translocation, is a key target for such structural studies.

  • Regulatory network mapping: Elucidating the complex network of proteins and signaling pathways that regulate V-ATPase assembly, localization, and activity in response to environmental cues would provide insights into plant adaptation mechanisms.

  • Engineering V-ATPases with modified properties: Using the recombinant expression systems already established for the 16 kDa proteolipid subunit to create V-ATPase variants with altered pH optima, coupling efficiency, or inhibitor sensitivity could lead to new tools for studying cellular pH regulation and potential biotechnological applications.

  • Comparative genomics and evolution: Expanding comparative analyses of V-ATPase subunits across diverse plant species, especially those adapted to extreme environments, could reveal how these essential enzymes have evolved to support specialized plant physiologies .

How might systems biology approaches enhance our understanding of V-ATPase function in plant cellular networks?

Systems biology offers powerful frameworks for investigating V-ATPase function:

  • Multi-omics integration: Combining proteomics, transcriptomics, and metabolomics data to analyze how V-ATPase expression, modification, and activity correlate with broader cellular processes under different conditions provides a comprehensive view of its roles in plant physiology.

  • Network modeling: Constructing mathematical models of the cellular networks involving V-ATPases can predict how changes in enzyme activity ripple through connected processes, generating testable hypotheses about system-level functions.

  • Flux analysis: Measuring proton fluxes, ATP consumption, and related metabolic parameters in intact cells or organelles enables quantitative assessment of V-ATPase contribution to cellular energetics under different conditions.

  • Comparative systems approaches: Applying systems biology tools across plant species with different V-ATPase structural features (as revealed by immunological studies) could identify how variations in enzyme structure affect entire cellular networks and organismal phenotypes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.