Recombinant Kangiella koreensis UPF0761 membrane protein Kkor_1635 (Kkor_1635)

What is Kkor_1635 and what is its basic structural composition?

Kkor_1635 is a UPF0761 membrane protein derived from Kangiella koreensis (strain DSM 16069 / KCTC 12182 / SW-125). It is a full-length protein consisting of 397 amino acids with a complete sequence from the N-terminal to C-terminal . The protein belongs to the UPF0761 family of membrane proteins, and its full amino acid sequence begins with MEKRWKWLKAFIKFVFIQFNQKQTSAMAAELTLSNMLALVPLMTVAVSLMAVFPSFEGVN and continues through to ALSDEKNDSFSTPIEQANLEMAKALDVELVSTNSVNS . The protein's membrane-spanning regions likely contribute to its integration within cellular membranes, consistent with the general structure of membrane proteins that are essential for various cellular functions.

How does Kkor_1635 compare to other bacterial membrane proteins in terms of function?

While specific functional information about Kkor_1635 is limited in the available research, membrane proteins generally are involved in a variety of crucial cellular processes. As a membrane protein, Kkor_1635 may participate in functions typical of this protein class, including ionic and molecular transport, signal transduction, enzymatic reactions, or intercellular communication . Despite membrane proteins constituting 25-30% of all proteins, they remain less structurally and functionally characterized compared to other protein types . Researchers working with Kkor_1635 would need to conduct comparative analysis with other bacterial membrane proteins to determine its specific functional characteristics and evolutionary relationships within the UPF0761 family.

What are the recommended protocols for purification of Kkor_1635 while maintaining structural integrity?

Purification of Kkor_1635 should follow protocols optimized for membrane proteins to maintain structural integrity. Based on product specifications, the protein has been successfully purified using affinity chromatography with His-tag fusion systems . For membrane proteins like Kkor_1635, a multi-step purification process is recommended: 1) Solubilization using appropriate detergents that maintain protein structure; 2) Affinity chromatography utilizing the His-tag; 3) Size exclusion chromatography to remove aggregates and ensure homogeneity . To verify purity, SDS-PAGE analysis should be performed, aiming for >90% purity as indicated in product specifications . During purification, researchers should consider using detergents compatible with downstream applications and potentially include stabilizing agents like glycerol (recommended at 5-50% final concentration) to prevent denaturation .

How should researchers approach reconstitution of lyophilized Kkor_1635 to ensure optimal activity?

The reconstitution of lyophilized Kkor_1635 requires specific conditions to ensure protein stability and activity. According to product specifications, the lyophilized protein should first be briefly centrifuged before opening to bring contents to the bottom of the vial . Reconstitution should be performed in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL . After reconstitution, it's recommended to add glycerol to a final concentration of 5-50% (with 50% being the default recommended concentration) before aliquoting for long-term storage at -20°C/-80°C . This approach helps maintain protein stability and prevents damage from repeated freeze-thaw cycles, which should be avoided as specified in the product guidelines . For membrane proteins like Kkor_1635, researchers might also consider reconstitution into artificial membranes or nanodiscs for functional studies, though specific protocols for this would need to be developed based on the protein's properties.

What blocking strategies are most effective in experimental designs involving Kkor_1635?

When designing experiments involving Kkor_1635, implementing effective blocking strategies can significantly improve the reliability of results. Blocking in experimental design groups similar experimental units together, reducing variability within each block and making treatment effects easier to detect . For membrane protein research specifically, blocking might involve grouping experiments by: 1) Protein batch to control for preparation variability; 2) Cell culture conditions during expression; 3) Purification date/conditions; or 4) Reconstitution parameters. This approach allows researchers to achieve more precise estimates with fewer experimental units, saving both time and resources . Additionally, blocking helps control for nuisance variables such as day-to-day laboratory variations, equipment differences, or reagent batches that might otherwise introduce bias into experimental results .

What are the optimal storage conditions for maintaining Kkor_1635 stability over time?

The optimal storage conditions for Kkor_1635 involve temperature, buffer composition, and aliquoting strategies to maintain protein stability. According to product specifications, reconstituted protein should be stored at -20°C/-80°C for extended storage periods . For working aliquots intended for short-term use, storage at 4°C for up to one week is recommended . The provided storage buffer typically contains Tris-based buffer with 50% glycerol, optimized specifically for this protein . The shelf life varies depending on storage form: liquid preparations generally maintain stability for approximately 6 months at -20°C/-80°C, while lyophilized preparations can remain stable for up to 12 months under the same conditions . Importantly, repeated freeze-thaw cycles should be avoided as they can cause protein degradation and loss of activity . Researchers should consider single-use aliquots sized appropriately for their experimental needs to minimize freeze-thaw cycles.

How does buffer composition affect the long-term stability of Kkor_1635?

Buffer composition significantly impacts the long-term stability of membrane proteins like Kkor_1635. The recommended storage buffer consists of a Tris-based buffer with 50% glycerol at pH 8.0 . This high glycerol concentration serves as a cryoprotectant, preventing ice crystal formation during freezing that could damage protein structure. The Tris buffer system at pH 8.0 provides optimal conditions for maintaining protein integrity by preventing pH shifts that could lead to denaturation. For membrane proteins specifically, buffer additives like trehalose (6% as mentioned in product specifications) can provide additional stability by preserving membrane protein structure during freeze-thaw cycles . When developing storage protocols for specific experiments, researchers might consider evaluating stability with additional components such as reducing agents, specific ions, or detergents that could further enhance Kkor_1635 stability depending on the intended applications and downstream assays.

What techniques are most effective for determining the membrane topology of Kkor_1635?

Determining the membrane topology of Kkor_1635 requires specialized techniques due to its membrane-embedded nature. For experimental approaches, researchers could employ: 1) Protease protection assays, where proteases are used to cleave exposed protein regions while membrane-embedded segments remain protected; 2) Site-directed fluorescence labeling at predicted loop regions followed by accessibility studies; 3) Cysteine scanning mutagenesis combined with thiol-specific labeling; or 4) Cryo-electron microscopy for high-resolution structural determination. Additionally, computational prediction methods can provide initial topology models based on the protein's amino acid sequence (MEKRWKWLKAFIKFVFIQFNQKQTSAMAAELTLSNMLALVPLMTVAVSLMAVFPSFEGVN... through ALSDEKNDSFSTPIEQANLEMAKALDVELVSTNSVNS) . These predictions can identify potential transmembrane helices, cytoplasmic loops, and extracellular domains that can then be experimentally verified. A combined approach utilizing both computational predictions and experimental validation would provide the most reliable topology model for Kkor_1635.

How can researchers overcome challenges in crystallizing Kkor_1635 for structural studies?

Crystallizing membrane proteins like Kkor_1635 presents significant challenges that require specialized approaches. To overcome these difficulties, researchers should consider: 1) Detergent screening - systematically testing different detergents and detergent mixtures to find optimal solubilization conditions that maintain native protein folding while allowing crystal contacts; 2) Lipidic cubic phase (LCP) crystallization - an alternative to traditional vapor diffusion methods that provides a more membrane-like environment conducive to membrane protein crystallization; 3) Protein engineering - creating fusion constructs or truncations that remove flexible regions while maintaining core structure to promote crystal formation; 4) Antibody fragment co-crystallization - using Fab or nanobody fragments that bind to the protein and provide additional surface area for crystal contacts. Additionally, high-throughput screening of crystallization conditions with specialized membrane protein screens can identify promising starting points for optimization. Researchers should also consider alternative structural determination methods like cryo-electron microscopy that may be more suitable for membrane proteins that resist crystallization.

What methodologies are recommended for investigating the potential transport function of Kkor_1635?

Investigating the potential transport function of Kkor_1635 requires specialized methodologies that accommodate its membrane-embedded nature. Researchers should consider these approaches: 1) Liposome reconstitution assays - where purified Kkor_1635 is incorporated into artificial liposomes containing fluorescent dyes or radiolabeled substrates to monitor transport activity; 2) Electrophysiological studies - using patch-clamp techniques on reconstituted proteoliposomes or expression systems to measure ion conductance; 3) Substrate binding assays - utilizing techniques like isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) to identify potential transported molecules; 4) Fluorescence-based flux assays - incorporating pH-sensitive or ion-sensitive fluorophores into proteoliposomes to monitor changes in internal conditions in response to potential substrates. For initial substrate screening, researchers should consider the natural environment of Kangiella koreensis and test physiologically relevant ions and molecules. Comparative analysis with functionally characterized members of the UPF0761 family, if available, could provide additional insights into potential transport substrates.

How can researchers design experiments to elucidate the role of Kkor_1635 in bacterial physiology?

Designing experiments to understand Kkor_1635's role in bacterial physiology requires a multi-faceted approach. Researchers should consider: 1) Gene knockout or knockdown studies in Kangiella koreensis to observe phenotypic changes, though this requires available genetic tools for this organism; 2) Heterologous expression in model organisms like E. coli with subsequent phenotypic characterization; 3) Transcriptomic analysis to identify conditions under which Kkor_1635 expression is up or downregulated, providing clues to its physiological role; 4) Protein-protein interaction studies using techniques like pull-down assays, co-immunoprecipitation, or bacterial two-hybrid systems to identify interaction partners that might suggest functional pathways. Additionally, researchers should examine the genomic context of the Kkor_1635 gene to identify potentially co-regulated genes or operons that might share related functions. Environmental stress response experiments (pH, osmolarity, temperature) could reveal conditions where Kkor_1635 plays a critical physiological role, particularly given the marine habitat of Kangiella koreensis.

What techniques can be used to investigate Kkor_1635 interactions with membrane lipids?

Investigating Kkor_1635 interactions with membrane lipids requires specialized techniques that can detect and characterize these associations. Researchers should consider: 1) Lipid binding assays using native mass spectrometry to identify specific lipids that co-purify with the protein; 2) Fluorescence-based approaches like Förster resonance energy transfer (FRET) between labeled protein and lipids to measure binding dynamics; 3) Differential scanning calorimetry to determine how lipid composition affects protein thermal stability; 4) Molecular dynamics simulations based on the protein sequence to predict lipid interaction sites within the membrane-spanning regions. Additionally, reconstitution of Kkor_1635 into nanodiscs or liposomes with defined lipid compositions can help identify lipid preferences that impact protein function or stability. The membrane environment of Kangiella koreensis, a marine bacterium, might suggest testing interactions with specific phospholipids, sterols, or other membrane components that could be physiologically relevant to its native environment.

How does lipid composition affect the structural stability and function of Kkor_1635?

The lipid composition of the membrane environment likely has significant effects on Kkor_1635 structural stability and function, as is common with membrane proteins. To investigate this relationship, researchers could: 1) Reconstitute the purified protein into liposomes with systematically varied lipid compositions and measure protein stability through thermal denaturation or proteolytic susceptibility; 2) Compare functional activity (if known) across different lipid environments to identify compositions that optimize performance; 3) Utilize solid-state NMR to examine how lipid interactions influence protein dynamics and conformation. Membrane proteins often have specific lipid requirements that affect their folding, oligomerization state, and activity. For Kkor_1635, researchers should consider testing physiologically relevant lipid compositions that reflect the marine environment of Kangiella koreensis, which might include higher proportions of charged lipids or specialized membrane components adapted to its native habitat. Understanding these lipid interactions could provide crucial insights into the protein's native function and evolutionary adaptations.

What strategies can overcome the common expression challenges encountered with recombinant Kkor_1635?

Expressing recombinant Kkor_1635 presents several challenges common to membrane proteins. To overcome these, researchers should consider: 1) Codon optimization for the expression host to address potential rare codon issues that might limit translation efficiency; 2) Fusion tags beyond the standard His-tag, such as MBP (maltose-binding protein) or SUMO tags that can enhance solubility and expression levels; 3) Controlled expression systems with tunable promoters to prevent toxic accumulation of the membrane protein; 4) Low-temperature induction protocols (16-20°C) that slow protein production and allow more time for proper membrane insertion; 5) Co-expression with chaperones that assist in proper folding . For Kkor_1635 specifically, successful expression has been reported in E. coli systems with N-terminal His-tags , but researchers experiencing difficulties might consider alternative expression hosts such as C41/C43 E. coli strains specifically designed for membrane protein expression, or eukaryotic systems for more complex membrane proteins .

How can Kkor_1635 be utilized in comparative studies of membrane protein evolution across marine bacteria?

Kkor_1635 presents an excellent opportunity for evolutionary studies of membrane proteins in marine bacteria. Researchers could approach this through: 1) Phylogenetic analysis comparing the Kkor_1635 sequence with homologous proteins from other marine bacteria to trace evolutionary relationships and selective pressures; 2) Structural comparisons between Kkor_1635 and related membrane proteins to identify conserved domains that might indicate functional importance; 3) Expression of Kkor_1635 and homologs in model organisms to compare functional characteristics across evolutionary distances; 4) Analysis of the genomic context of Kkor_1635 across different bacterial species to identify conserved gene neighborhoods that might suggest functional associations. Such comparative studies could reveal how membrane proteins like Kkor_1635 have adapted to different marine environments and provide insights into the evolution of membrane protein structure and function in response to specific ecological niches. This research direction would contribute to our understanding of bacterial adaptation mechanisms in marine ecosystems and potentially identify novel functional properties unique to certain bacterial lineages.

What are the methodological considerations for using Kkor_1635 in membrane protein folding and stability studies?

Using Kkor_1635 in membrane protein folding and stability studies requires careful methodological considerations. Researchers should: 1) Develop reliable refolding protocols that can restore native structure after denaturation, possibly using systematic screening of detergents, lipids, and buffer conditions; 2) Employ spectroscopic techniques like circular dichroism (CD) to monitor secondary structure changes under various conditions; 3) Utilize differential scanning calorimetry or differential scanning fluorimetry to quantitatively measure stability under varying conditions; 4) Consider site-directed mutagenesis of key residues to probe their contribution to folding pathways and stability determinants. For comparative studies, researchers could express and analyze Kkor_1635 alongside well-characterized membrane proteins to benchmark its folding and stability properties. Additionally, computational approaches like molecular dynamics simulations based on the protein sequence (MEKRWKWLKAFIKFVFIQFNQKQTSAMAAELTLSNMLALVPLMTVAVSLMAVFPSFEGVN... through ALSDEKNDSFSTPIEQANLEMAKALDVELVSTNSVNS) could provide insights into folding mechanisms and stability determinants that can be experimentally verified.

What are the most promising future research directions for understanding Kkor_1635 function?

The most promising future research directions for understanding Kkor_1635 function include: 1) Comprehensive structural characterization using cryo-electron microscopy or X-ray crystallography to resolve the three-dimensional structure, which would provide crucial insights into potential functions based on structural motifs; 2) Functional screening assays to identify potential substrates, interacting partners, or enzymatic activities, particularly focusing on probable functions like transport, signaling, or enzymatic activities common to membrane proteins ; 3) In vivo studies in the native Kangiella koreensis or model organisms to understand the physiological role of the protein; 4) Comparative genomic and proteomic analyses to identify functional relationships with other proteins in related organisms. As membrane proteins constitute 25-30% of all proteins yet remain less characterized than other protein types , advances in understanding Kkor_1635 could contribute significantly to the broader field of membrane protein biology, potentially revealing novel functions or structural motifs unique to marine bacterial adaptations.

How can researchers integrate structural, functional, and evolutionary data to develop a comprehensive model of Kkor_1635?

Developing a comprehensive model of Kkor_1635 requires the integration of multiple data types through a coordinated research approach. Researchers should consider: 1) Creating iterative models that begin with sequence-based predictions and are progressively refined with experimental structural data from techniques like cryo-EM, NMR, or X-ray crystallography; 2) Overlaying functional data from transport assays, binding studies, or in vivo experiments onto structural models to identify structure-function relationships; 3) Incorporating evolutionary data through multiple sequence alignments and analysis of conservation patterns to identify functionally significant regions; 4) Utilizing molecular dynamics simulations to explore dynamic aspects of the protein's behavior in membrane environments. This integrated approach should be implemented in stages, with initial models guiding experimental design, and experimental results refining subsequent models. The final comprehensive model should encompass the protein's structure, membrane topology, functional mechanisms, and evolutionary context, providing testable hypotheses for future research and potentially revealing novel insights into the UPF0761 family of membrane proteins.