Recombinant Kineococcus radiotolerans UPF0060 membrane protein Krad_3114 (Krad_3114)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Kineococcus radiotolerans UPF0060 Membrane Protein Krad_3114 (Krad_3114)

Kineococcus radiotolerans UPF0060 membrane protein Krad_3114 (Krad_3114) is a protein derived from the bacterium Kineococcus radiotolerans . Specifically, it is a recombinant, full-length version of the UPF0060 membrane protein Krad_3114, tagged with histidine (His) . The protein is produced in E. coli expression systems and is identified by the UniProt ID A6WCN9 . Krad_3114 belongs to the UPF0060 protein family and is located in the cell membrane, characterized as a multi-pass membrane protein.

Biological Context and Potential Functions

The protein Krad_3114 is found in Kineococcus radiotolerans, a bacterium notable for its ability to withstand high levels of ionizing radiation . Proteins with unknown function (UPF) may play roles in stress response or maintaining cellular integrity under extreme conditions. Membrane proteins are involved in various cellular processes, including transport, signaling, and maintaining cell structure .

Database Links

Krad_3114 has entries in several biological databases, including:

  • KEGG: kra:Krad_3114

  • STRING: 266940.Krad_3114

These links provide additional information, such as genetic context, protein interactions, and functional annotations, which can be valuable in understanding the role of Krad_3114.

Tables and Figures in Scientific Writing

When presenting information about Krad_3114 or other proteins, tables and figures should be constructed to clearly and effectively communicate results . Tables are useful for presenting precise numerical data and specific details, while figures are better for showing trends, patterns, and relationships . Titles and column headings should be descriptive, and the table should be understandable on its own, without reference to the text .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Krad_3114; UPF0060 membrane protein Krad_3114
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Target Names
Krad_3114
Target Protein Sequence
MDVLRSIALFVLAALLEIGGAWLVWQGVREHRGLAWIGAGVIALGLYGFAATLQPEAQFG RVLAAYGGVFVAGSLLWAAVVDGYRPDRFDVAGALVCLVGVGIVMYAPRPS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Kineococcus radiotolerans UPF0060 membrane protein Krad_3114?

Krad_3114 is a membrane protein derived from the bacterium Kineococcus radiotolerans. Specifically, it's a recombinant, full-length version of the UPF0060 membrane protein, typically tagged with histidine (His) for purification purposes. The protein is commonly produced in E. coli expression systems and is identified by the UniProt ID A6WCN9. It belongs to the UPF0060 protein family and is characterized as a multi-pass membrane protein, meaning it traverses the cell membrane multiple times.

What are the primary structural characteristics of Krad_3114?

Krad_3114 is classified as a membrane protein within the UPF0060 family. Its structural features include:

  • Multi-pass transmembrane topology

  • Histidine tag for purification (in recombinant form)

  • Conserved domains characteristic of the UPF0060 family

When designing experiments to investigate its structure, researchers should consider appropriate membrane mimetics for stabilization and techniques optimized for membrane proteins, such as detergent screening and lipid reconstitution approaches.

What is known about the organism Kineococcus radiotolerans and why is it significant?

Kineococcus radiotolerans is a bacterium notably characterized by its exceptional ability to withstand high levels of ionizing radiation. This extreme radiation resistance makes it particularly interesting for studying cellular survival mechanisms under harsh conditions. The UPF0060 family proteins, including Krad_3114, may potentially play roles in stress response pathways or in maintaining cellular integrity under these extreme conditions, though specific functions remain to be fully elucidated.

How should researchers design experiments to study Krad_3114 while minimizing bias?

When designing experiments to study Krad_3114, researchers should implement rigorous measures to reduce bias:

  • Randomization: Randomly allocate samples to treatment groups to reduce selection bias. This formal process should use systematic approaches like computer-generated random numbers, not haphazard selection. Only 12% of studies in biomedical research properly report randomization .

  • Blinding: Implement blinded assessment when making qualitative observations or measurements to minimize subjective bias. Researchers should not know which treatment each sample received during assessment .

  • Factorial Designs: When studying multiple variables that might affect Krad_3114's behavior, use factorial experimental designs that allow evaluation of multiple factors simultaneously. This approach maximizes information gained while potentially reducing sample numbers .

  • Controls: Include appropriate positive and negative controls specific to membrane protein studies, including empty vector controls and well-characterized membrane proteins with similar properties.

These design elements significantly enhance the validity of findings and improve the reproducibility of research involving complex membrane proteins like Krad_3114 .

What expression systems are recommended for producing recombinant Krad_3114?

The recommended expression systems for producing recombinant Krad_3114 include:

  • E. coli-based systems: Currently the most commonly used approach for Krad_3114 expression. Consider these methodological details:

    • Use of specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3))

    • Temperature optimization (typically lower temperatures of 16-25°C)

    • Induction conditions (IPTG concentration titration)

    • Expression vector selection with appropriate promoters and fusion tags

  • Alternative expression systems may be worth exploring for improved yield or functional studies:

    • Yeast systems (Pichia pastoris, Saccharomyces cerevisiae)

    • Cell-free expression systems

    • Mammalian cell expression for complex functional studies

Researchers should conduct small-scale expression trials with multiple conditions before scaling up, and carefully document all optimization parameters to ensure reproducibility.

What purification strategies are most effective for Krad_3114?

For effective purification of Krad_3114, consider this methodological workflow:

  • Membrane preparation:

    • Cell lysis optimization (sonication, French press, or enzymatic methods)

    • Differential centrifugation to isolate membrane fractions

    • Membrane solubilization screening with various detergents

  • Affinity chromatography:

    • Utilize the histidine tag with Ni-NTA or TALON resins

    • Optimize imidazole concentrations in wash and elution buffers

    • Consider detergent exchange during purification

  • Secondary purification:

    • Size exclusion chromatography to achieve monodispersity

    • Ion exchange chromatography if additional purity is required

  • Quality control assessments:

    • SDS-PAGE and Western blotting

    • Mass spectrometry verification

    • Dynamic light scattering for homogeneity assessment

The selection of detergents is particularly critical, as inappropriate detergents can lead to protein denaturation or aggregation, compromising downstream analyses.

How should researchers approach data sharing when working with Krad_3114?

When working with Krad_3114, researchers should consider the following data sharing practices to enhance scientific progress:

  • Data types to share:

    • Expression conditions and optimization parameters

    • Purification protocols with detailed buffer compositions

    • Raw data from structural or functional experiments

    • Analysis scripts and processing workflows

  • Sharing mechanisms:

    • Deposit sequences and structural data in appropriate databases (UniProt, PDB)

    • Share detailed protocols on platforms like protocols.io

    • Consider preprint repositories for early sharing of findings

    • Include comprehensive methods sections in publications

  • Addressing barriers:

    • Use standardized metadata to enhance interoperability

    • Implement appropriate formatting standards

    • Address confidentiality concerns through proper anonymization

Studies indicate that data sharing accelerates scientific progress by helping find synergies, avoiding redundant work, and enabling more rigorous review processes. Approximately 67% of researchers agree that lack of access to data generated by others represents a major impediment to scientific advancement .

What quality control measures should be implemented in Krad_3114 research?

Robust quality control measures for Krad_3114 research should include:

  • Protein characterization:

    • Purity assessment via multiple methods (SDS-PAGE, mass spectrometry)

    • Stability monitoring with thermal shift assays or circular dichroism

    • Functional verification through activity assays when applicable

  • Experimental validation:

    • Biological replicates (minimum n=3) with statistical analysis

    • Technical replicates to assess method reliability

    • Positive and negative controls specific to each assay

  • Statistical considerations:

    • Appropriate statistical tests based on data distribution

    • Reporting of p-values, confidence intervals, and effect sizes

    • Avoidance of p-hacking through pre-planned analyses

  • Documentation:

    • Comprehensive laboratory notebooks with all parameters

    • Raw data preservation in accessible formats

    • Detailed methods sections that enable reproduction

Implementing these measures significantly enhances research reproducibility and validity. Studies have shown that experimental designs which minimize bias produce more accurate estimates of treatment effects and improve the robustness of scientific results .

How can structural studies of Krad_3114 be optimized?

Optimizing structural studies of Krad_3114 requires careful consideration of multiple techniques and approaches:

  • Crystallography approaches:

    • Screening multiple constructs with variable termini

    • Extensive crystallization condition screening

    • Use of lipidic cubic phase for membrane protein crystallization

    • Co-crystallization with antibody fragments or stabilizing partners

  • Cryo-EM considerations:

    • Optimization of vitrification conditions

    • Screening of various grid types and treatment protocols

    • Sample concentration adjustment for optimal particle distribution

    • Collection parameters optimization for membrane proteins

  • Complementary methods:

    • Small-angle X-ray scattering (SAXS) for solution studies

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

    • Nuclear magnetic resonance for specific domain analysis

  • In silico approaches:

    • Homology modeling based on related UPF0060 family members

    • Molecular dynamics simulations in membrane environments

    • Structure prediction using modern deep learning approaches

Each approach requires methodological optimization specific to membrane proteins, with particular attention to maintaining native-like environments during preparation and analysis.

What functional characterization approaches are recommended for UPF0060 family proteins like Krad_3114?

For functional characterization of UPF0060 family proteins like Krad_3114, consider these methodological approaches:

  • Stress response studies:

    • Exposure to radiation and oxidative stressors

    • Growth phenotype analysis under various stress conditions

    • Cellular localization changes during stress response

  • Interaction studies:

    • Pull-down assays with potential interacting partners

    • Crosslinking mass spectrometry for interaction mapping

    • Proximity labeling approaches (BioID, APEX)

    • Co-immunoprecipitation from native conditions

  • Genetic approaches:

    • Gene knockout or knockdown studies

    • Complementation assays with mutant constructs

    • Transcriptional response analysis

  • Systems biology integration:

    • Network analysis using STRING database (266940.Krad_3114)

    • Pathway mapping through KEGG resources (kra:Krad_3114)

    • Comparative genomics across radiation-resistant organisms

Given the limited knowledge of UPF0060 family functions, a multi-faceted approach combining several of these methods would likely yield the most comprehensive insights.

How should researchers analyze and interpret contradictory data when studying Krad_3114?

When facing contradictory data in Krad_3114 research, implement this systematic approach:

  • Methodological assessment:

    • Critically review experimental conditions across contradictory studies

    • Evaluate protein quality/purity differences between experiments

    • Assess statistical power and sample sizes

  • Biological variability considerations:

    • Investigate expression construct differences (tags, linkers)

    • Consider detergent/lipid environment variations

    • Evaluate differences in expression systems

  • Resolution strategies:

    • Design experiments specifically to address the contradiction

    • Implement multiple orthogonal techniques to cross-validate findings

    • Consider collaborative validation across laboratories

  • Reporting framework:

    • Transparently report all contradictory findings

    • Discuss potential sources of variation

    • Present alternative hypotheses that reconcile contradictions

Studies have shown that experimental design factors significantly impact results, with designs that minimize bias providing more accurate estimates of effects. Therefore, carefully evaluating methodological differences is essential when resolving contradictory findings .

How does Krad_3114 compare to other UPF0060 family proteins across species?

Comparative analysis of Krad_3114 with other UPF0060 family proteins should consider:

  • Sequence comparison:

    • Multiple sequence alignment of UPF0060 family members

    • Identification of conserved domains and residues

    • Analysis of radiation-resistant vs. non-resistant species

  • Structural comparison:

    • Homology modeling based on available structures

    • Comparison of predicted transmembrane topologies

    • Analysis of potential functional sites based on conservation

  • Genomic context:

    • Analysis of gene neighborhoods across species

    • Identification of co-evolved gene clusters

    • Promoter region comparison for regulatory insights

  • Phylogenetic analysis:

    • Construction of phylogenetic trees for UPF0060 family

    • Correlation with organisms' radiation resistance capabilities

    • Evolutionary rate analysis

This comparative approach may reveal evolutionary adaptations associated with radiation resistance and provide insights into functional specialization within the UPF0060 family.

How can researchers effectively use bioinformatics resources for Krad_3114 studies?

For effective bioinformatics analysis of Krad_3114, researchers should utilize:

  • Database resources:

    • UniProt (A6WCN9) for sequence and annotation data

    • KEGG (kra:Krad_3114) for pathway mapping

    • STRING (266940.Krad_3114) for protein interaction networks

  • Structural prediction tools:

    • AlphaFold or RoseTTAFold for structure prediction

    • TMHMM or TOPCONS for transmembrane topology prediction

    • ConSurf for evolutionary conservation mapping

  • Functional prediction approaches:

    • Gene Ontology enrichment analysis

    • CATH or SCOP domain prediction and classification

    • Protein family databases (Pfam, InterPro)

  • Integration strategies:

    • Multi-database queries for comprehensive information

    • Version tracking for reproducible analyses

    • API utilization for automated data retrieval

When presenting bioinformatics findings, researchers should clearly document all parameters, software versions, and database access dates to ensure reproducibility.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.