Recombinant Klebsiella pneumoniae 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Ubiquinone Biosynthesis

UbiA is central to the ubiquinone pathway, enabling electron transport and proton pumping in bacterial membranes. The enzyme’s activity is conserved across Gram-negative pathogens, including Klebsiella pneumoniae, Escherichia coli, and Acinetobacter baumannii .

Mechanistic Insights

  • Catalytic Process: UbiA transfers an octaprenyl group from octaprenyl pyrophosphate to 4-HB, forming 4-H-3-OPB .

  • Substrate Specificity: The enzyme’s active site (Asp191 and Arg72) binds 4-HB with high affinity, a feature exploited by inhibitors like 3,6-dihydroxy-1,2-benzisoxazole (DHB) .

  • Pathway Disruption: Inhibition of UbiA halts UQ8 production, impairing NADH oxidation and membrane potential .

Research on Inhibitors and Resistance

DHB, a small molecule produced by Photorhabdus, acts as a competitive inhibitor of UbiA. Key findings include:

DHB’s Dual Mechanism

MechanismEffectSource
Competitive InhibitionBinds UbiA’s active site, blocking 4-HB prenylation
Toxic ProdrugUbiA prenylates DHB to form 4-hydroxy-3-octaprenyl-DHB (DHB8), which disrupts downstream ubiquinone synthesis

Resistance Mutations

Mutations in ubiA (e.g., W170R, P166L) reduce DHB binding affinity, conferring resistance. These mutations occur in conserved residues critical for substrate recognition .

MutationMIC (μg/mL)Effect on DHB BindingSource
W170R16Diminished substrate interaction
P166L8Altered active site conformation

Vaccine Development

Recombinant UbiA is explored as a potential vaccine antigen, though current focus remains on outer membrane proteins like OmpA and OmpK36 for Klebsiella vaccines .

Enzymatic Studies

  • Prenyltransferase Family: UbiA belongs to the UbiA superfamily, which includes enzymes for ubiquinones, menaquinones, and structural lipids .

  • Structural Analyses: Crystallization studies of UbiA homologs (e.g., E. coli UbiA) reveal a membrane-embedded fold with distinct substrate channels .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Please note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We advise storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
ubiA; KPK_5248; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-288
Protein Length
full length protein
Species
Klebsiella pneumoniae (strain 342)
Target Names
ubiA
Target Protein Sequence
MEWSLSQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVASPGVPPLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTARRPLPSGDVTEKEARTLFIVLVLLSFLLVLTLNTMTIL LSVAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFSAVSESLPLSCWLMFLANILWA VAYDTQYAMVDRDDDVKIGIKSTAILFGENDRLIIGILQVAVLALMGAVGWLNGLGWEYY WSLFVAAGLFGWQQKLIFNRERDNCFKAFMNNNYVGLVLFLGLAMSYL
Uniprot No.

Target Background

Function
This enzyme catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. It plays a crucial role in the biosynthesis of ubiquinone-8 (UQ-8), mediating the second step in the final reaction sequence. This step involves the condensation of the polyisoprenoid side chain with PHB, generating the first membrane-bound Q intermediate 3-octaprenyl-4-hydroxybenzoate.
Database Links

KEGG: kpe:KPK_5248

Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of UbiA in Klebsiella pneumoniae metabolism?

UbiA (4-hydroxybenzoate octaprenyltransferase) is a critical enzyme in the ubiquinone biosynthesis pathway of K. pneumoniae. In the early steps of this pathway, chorismate pyruvate-lyase (UbiC) forms 4-hydroxybenzoate (4-HB) and pyruvate from chorismate . UbiA then catalyzes the formation of 4-hydroxy-3-octaprenylbenzoate (4-H-3-OPB) from 4-HB and octaprenyl pyrophosphate . This product continues through a series of decarboxylation, hydroxylation, and methylation reactions to ultimately form ubiquinone-8 (UQ 8), an essential component of the electron transport chain . The ubiquinone biosynthesis pathway is particularly important in Gram-negative bacteria where ubiquinone serves as a critical electron carrier in aerobic respiration.

How does UbiA structure differ between K. pneumoniae and other bacterial species?

While the search results don't directly compare UbiA structural differences across bacterial species, research indicates that the selectivity of antimicrobial compounds targeting UbiA depends on the particular fold of the enzyme . The 3,6-dihydroxy-1,2-benzisoxazole (DHB) antimicrobial compound shows activity against several Gram-negative bacteria including Escherichia coli, Enterobacter cloacae, Klebsiella pneumoniae, and Acinetobacter baumannii, suggesting that the UbiA enzymes in these species share sufficient structural similarity at the binding site to be targeted by the same compound . Nevertheless, subtle structural differences in the active site or protein fold likely exist between species, which could be exploited for species-specific targeting in antimicrobial development.

What are the common expression systems for recombinant K. pneumoniae UbiA production?

Although the search results don't specifically address expression systems for K. pneumoniae UbiA, typical approaches for membrane-bound bacterial enzymes like UbiA often involve E. coli-based expression systems. When working with membrane proteins such as UbiA, researchers typically employ specialized E. coli strains designed for membrane protein expression, along with inducible vector systems like pET or pBAD. Expression optimization typically involves testing different induction conditions (temperature, inducer concentration, duration) and using detergents for solubilization. Purification often employs affinity tags such as His6 or Strep-tag. For functional studies, reconstitution into liposomes or nanodiscs may be necessary to maintain the native-like membrane environment required for UbiA activity.

How can one design experiments to study UbiA inhibition mechanisms in K. pneumoniae?

Designing experiments to study UbiA inhibition requires a multi-faceted approach. Based on research with DHB inhibition of UbiA, effective experimental designs include:

  • Competitive Binding Assays: Design experiments that measure UbiA activity with varying concentrations of both substrate (4-HB) and potential inhibitor . The search results show that when 4-HB concentrations increase in bacterial cells (as in the ΔaaeB strain), more DHB is required for inhibition (16-64 μg/mL compared to the normal 2 μg/mL), indicating competitive binding .

  • Mutation Studies: Generate targeted mutations in the ubiA gene to identify residues critical for inhibitor binding. The search results mention that "mutants resistant to DHB map to the ubiquinone biosynthesis pathway," suggesting that specific mutations can confer resistance .

  • Product Analysis: Employ chromatographic techniques coupled with mass spectrometry to identify and quantify the normal products (4-H-3-OPB) and any altered products formed in the presence of inhibitors . For instance, research shows that DHB itself gets prenylated, forming a chimeric product that contributes to its toxic effect .

  • Media Composition Control: As shown with DHB, potency can vary with media composition. The research found "a loss of DHB potency upon the addition of glucose, a known repressor of ubiA transcription" . Therefore, experiments should control for media components that affect ubiA expression.

  • Transporter Manipulation: Engineer strains with modified efflux pumps to control intracellular concentrations of compounds. The study demonstrated this approach by manipulating the AaeAB pump, which controls 4-HB levels inside cells .

What methodologies are most effective for analyzing UbiA substrate specificity?

Effective methodologies for analyzing UbiA substrate specificity include:

  • Structural Biology Approaches: X-ray crystallography or cryo-electron microscopy of UbiA with different substrates can reveal binding pocket preferences and interaction mechanisms.

  • Enzyme Kinetics: Measure reaction velocities with various substrate analogs to determine Km and Vmax values, providing quantitative comparisons of substrate preferences.

  • Product Analysis: Use HPLC-MS to identify and quantify reaction products when UbiA is provided with different substrate analogs, as demonstrated in the DHB research where researchers identified that "DHB itself is prenylated, forming an unusable chimeric product" .

  • Competitive Assays: Compare the enzyme's ability to utilize different substrates in competitive conditions, similar to how researchers found that increased 4-HB levels could outcompete DHB in the ΔaaeB mutant .

  • Molecular Docking and Simulations: Computational methods can predict binding affinities of different substrates and identify key interaction residues.

  • Site-Directed Mutagenesis: Systematically modify residues in the binding pocket to assess their impact on different substrate interactions.

How can machine learning approaches improve prediction of UbiA mutations conferring antimicrobial resistance?

Machine learning (ML) approaches show significant promise for predicting antimicrobial resistance mechanisms, including those involving UbiA mutations. Based on the search results:

The table below summarizes prediction accuracy for K. pneumoniae antimicrobial resistance using different ML approaches:

ML MethodAccuracy Range Across Antimicrobials
Gradient Boosting>90% (best performer)
k-nearest neighbors>83% (second best)
Other ML models>83%

What controls are essential when studying UbiA inhibition by natural compounds?

When studying UbiA inhibition by natural compounds like DHB, several essential controls must be incorporated:

  • Growth Media Controls: The research showed that "Differing amounts of 4-HB and glucose in the growth media" significantly affected DHB potency, with glucose repressing ubiA transcription . Therefore, standardized media composition is critical, and parallel experiments with varied media formulations should be conducted to understand environmental effects.

  • Substrate Competition Controls: Include varying concentrations of the natural substrate (4-HB) to distinguish competitive from non-competitive inhibition mechanisms . The research demonstrated that higher intracellular 4-HB levels in ΔaaeB strains reduced DHB effectiveness .

  • Pathway Manipulation Controls: Include strains with modifications in related pathways. For example, the research used ΔaaeB and ΔtolC strains to manipulate 4-HB transport , and observed that "Δaaeβ required four- to sixfold more DHB (16–64 μg/mL) for inhibition" .

  • Genetic Complementation: Include rescue experiments where wild-type ubiA is reintroduced to resistant mutants to confirm that resistance is specifically due to ubiA mutations.

  • Specificity Controls: Test inhibition of related enzymes to confirm target specificity. The research showed that DHB was "inactive against anaerobic gut bacteria and nontoxic to human cells" , demonstrating its selectivity.

  • Product Formation Analysis: Monitor both normal and abnormal product formation. The research discovered that DHB has a dual mode of action: it competitively inhibits UbiA and is also modified by UbiA into a toxic product .

How should researchers design experiments to resolve contradictory data in UbiA studies?

When faced with contradictory data in UbiA studies, researchers should implement the following experimental design strategies:

  • Standardize Methods and Conditions: The search results highlight how "Reported DHB potencies in the previous literature range from <1 μg/mL to >500 μg/mL" . These discrepancies were attributed to "Differing amounts of 4-HB and glucose in the growth media and varying methods of MIC testing" . Researchers should therefore standardize testing methods and clearly report all experimental conditions.

  • Systematic Variable Isolation: Methodically isolate and test each variable that might contribute to contradictory results. For example, if DHB potency varies across studies, systematically test different media compositions, bacterial growth phases, and measurement techniques.

  • Cross-Laboratory Validation: Implement a multi-laboratory approach where identical experiments are performed in different settings to identify environment-specific variables affecting outcomes.

  • Combined Methodologies: Apply complementary experimental approaches to the same question. For example, combine genetic, biochemical, and structural methods to understand UbiA inhibition mechanisms.

  • Statistical Robustness: Ensure adequate statistical power through appropriate sample sizes and replicate numbers, and apply rigorous statistical analysis to determine significance of observed differences.

  • Meta-Analysis Approach: When multiple studies report contradictory findings, conduct a formal meta-analysis that weights studies based on methodological quality and sample size.

  • Randomization and Blinding: Implement proper randomization of samples and blinding of analysis where possible to reduce experimental bias, following experimental design best practices .

How can researchers distinguish between direct and indirect effects on UbiA function?

Distinguishing between direct and indirect effects on UbiA function requires careful experimental design and data analysis:

  • In Vitro Reconstitution: Purify UbiA and reconstitute its activity in a defined system with minimal components. This approach can confirm direct interactions, as demonstrated in the research showing that "DHB binds to 4-hydroxybenzoate octaprenyltransferase (UbiA)" .

  • Direct Binding Assays: Employ techniques like isothermal titration calorimetry, surface plasmon resonance, or fluorescence polarization to measure direct binding of compounds to UbiA.

  • Structure-Function Analysis: Use site-directed mutagenesis to modify specific residues in UbiA and observe how these mutations affect both the normal enzyme function and the response to potential inhibitors.

  • Genetic Bypass Experiments: Introduce alternative pathways that can compensate for UbiA function. If an observed effect persists despite functional bypass of UbiA, it suggests an indirect mechanism.

  • Temporal Analysis: Monitor the sequence of events following treatment. Immediate effects on UbiA activity suggest direct interaction, while delayed effects may indicate indirect mechanisms through regulatory or secondary pathways.

  • Dose-Response Relationships: Compare dose-response curves for effects on UbiA activity versus other cellular processes. Different EC50 values suggest separate mechanisms.

  • Chemical Genetics: Use libraries of compounds with known mechanisms to identify patterns of cross-resistance or cross-sensitivity that can distinguish direct from indirect effects.

What are the appropriate statistical methods for analyzing UbiA inhibition data?

Appropriate statistical methods for analyzing UbiA inhibition data include:

  • Enzyme Kinetics Models: For competitive inhibitors like DHB , use Lineweaver-Burk, Eadie-Hofstee, or nonlinear regression analysis to determine inhibition constants (Ki) and distinguish between competitive, non-competitive, and uncompetitive inhibition.

  • Dose-Response Analysis: Apply four-parameter logistic regression to determine IC50 values and Hill coefficients for inhibition curves.

  • Multiple Comparison Corrections: When testing multiple inhibitors or conditions, apply Bonferroni, Tukey, or false discovery rate corrections to avoid type I errors.

  • ANOVA and Post-Hoc Tests: Use ANOVA followed by appropriate post-hoc tests when comparing inhibition across multiple conditions or inhibitor types.

  • Bootstrapping and Permutation Tests: For datasets with uncertain distributions, employ non-parametric approaches to establish confidence intervals.

  • Machine Learning for Complex Datasets: For high-dimensional data integrating multiple variables, machine learning approaches similar to those used for antimicrobial resistance prediction can be applied . The search results demonstrate how "k-nearest neighbors ML model" achieved high accuracy values for antimicrobial prediction .

  • Bayesian Analysis: Particularly useful when incorporating prior knowledge about inhibition mechanisms or when analyzing time-course data.

How might UbiA research inform the development of novel anti-Klebsiella therapeutics?

UbiA research offers several promising avenues for developing novel anti-Klebsiella therapeutics:

  • Structure-Based Drug Design: Detailed structural understanding of K. pneumoniae UbiA can guide the rational design of selective inhibitors. The research already demonstrated that DHB "binds to 4-hydroxybenzoate octaprenyltransferase (UbiA) and prevents the formation of 4-hydroxy-3-octaprenylbenzoate" .

  • Dual-Action Inhibitors: The discovery that DHB has a "dual mode of action" as both "a competitive enzyme inhibitor and a prodrug" suggests a novel inhibition strategy where compounds both inhibit enzyme function and are processed into toxic products.

  • Selectivity Enhancement: Further understanding of the "mechanism of DHB selectivity, which depends on a particular fold of the UbiA enzyme" could lead to antibiotics that specifically target pathogenic bacteria while sparing beneficial microbiota.

  • Resistance Prediction: Machine learning approaches demonstrated for predicting antimicrobial resistance could be applied specifically to predict resistance to UbiA inhibitors, allowing for proactive therapeutic development and personalized treatment approaches.

  • Combination Therapies: Understanding how UbiA inhibition affects other cellular processes could inform the development of synergistic combination therapies targeting multiple bacterial systems simultaneously.

  • Prodrug Approach: The observation that DHB "is prenylated, forming an unusable chimeric product that likely contributes to the toxic effect" suggests a prodrug approach where compounds are activated by bacterial enzymes into toxic products.

What technological advances would most benefit UbiA research in K. pneumoniae?

Several technological advances would significantly benefit UbiA research in K. pneumoniae:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.