Recombinant Klebsiella pneumoniae ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Klebsiella pneumoniae ATP Synthase Subunit a (atpB)

Recombinant Klebsiella pneumoniae ATP synthase subunit a (atpB) represents a laboratory-produced version of the naturally occurring atpB protein found in K. pneumoniae bacteria. This protein is typically expressed in Escherichia coli expression systems to facilitate large-scale production and purification for research applications . The recombinant form often includes modifications such as histidine tags to enhance purification efficiency while maintaining the structural and functional properties of the native protein.

ATP synthase is a multi-subunit enzyme complex that plays a fundamental role in energy production in bacteria. It functions as a molecular machine that synthesizes adenosine triphosphate (ATP), the primary energy currency of cells, through the process of oxidative phosphorylation. The subunit a (atpB) is part of the F0 sector of ATP synthase, which is embedded in the bacterial membrane and forms the proton channel necessary for ATP synthesis.

Klebsiella pneumoniae has gained significant attention as a globally disseminated opportunistic pathogen capable of causing life-threatening infections. It has been identified as the causative agent in numerous hospital outbreaks, particularly affecting vulnerable populations such as newborns and adults in intensive care units . With the increasing prevalence of multidrug-resistant strains producing extended-spectrum β-lactamases, understanding the basic biology of this organism, including its energy metabolism machinery, has become critically important for developing new therapeutic strategies.

Gene Information and Classification

The atpB gene in K. pneumoniae encodes the ATP synthase subunit a. In genomic databases and scientific literature, it is also known by several synonyms:

  • atpB

  • KPK_5538

  • ATP synthase F0 sector subunit a

  • F-ATPase subunit 6

This gene is part of the ATP synthase operon, which contains genes encoding various subunits of the ATP synthase complex. The coordinated expression of these genes ensures the proper assembly and function of the complete ATP synthase enzyme, which is essential for bacterial energy metabolism and survival.

Expression Systems

The production of recombinant K. pneumoniae atpB typically employs bacterial expression systems, with E. coli being the most commonly used host organism. This expression system offers several advantages for recombinant protein production, including rapid growth, well-established genetic tools, and high protein yields .

For membrane proteins like atpB, expression can be challenging due to their hydrophobic nature and the potential for toxicity to the host cell. Specialized E. coli strains and expression vectors have been developed to overcome these challenges, often incorporating features such as tightly controlled promoters and fusion tags to enhance solubility and facilitate purification.

Purification Methods

The purification of recombinant K. pneumoniae atpB typically involves a multi-step process designed to isolate the protein with high purity while maintaining its structural integrity. The general purification workflow includes:

  1. Cell lysis to release the expressed protein

  2. Membrane extraction using appropriate detergents

  3. Affinity chromatography, leveraging the His-tag for selective binding

  4. Optional additional purification steps (e.g., ion exchange or size exclusion chromatography)

  5. Quality control assessment, typically by SDS-PAGE analysis

The purified protein is often lyophilized (freeze-dried) for long-term storage and stability . This process removes water while preserving the protein structure, resulting in a powder form that can be reconstituted when needed for experimental use.

Quality Assessment and Validation

The quality of purified recombinant atpB is typically assessed using several complementary methods:

  • SDS-PAGE to evaluate protein purity and molecular weight

  • Western blotting for identity confirmation

  • Mass spectrometry for detailed compositional analysis

  • Functional assays to verify biological activity

Commercial preparations of recombinant K. pneumoniae atpB typically achieve purity levels greater than 90%, as determined by SDS-PAGE analysis . This high level of purity is essential for ensuring reliable and reproducible results in downstream applications.

Energy Metabolism and ATP Production

ATP synthase plays a central role in bacterial energy metabolism, serving as the final step in oxidative phosphorylation. The enzyme utilizes the energy stored in a transmembrane proton gradient to catalyze the synthesis of ATP from adenosine diphosphate (ADP) and inorganic phosphate, providing the energy currency essential for cellular functions.

The ATP synthase complex consists of two main portions:

  1. F1 sector: Contains the catalytic sites for ATP synthesis and is located on the cytoplasmic side of the membrane

  2. F0 sector: Embedded in the membrane and forms the proton channel

Relation to Bacterial Virulence and Pathogenicity

Energy production through ATP synthase is fundamental to numerous bacterial processes, including those directly related to virulence and pathogenicity:

  • Cell division and growth

  • Nutrient transport

  • Motility

  • Virulence factor production

  • Stress response mechanisms

  • Antibiotic resistance mechanisms

In K. pneumoniae, energy metabolism is particularly important for survival in diverse host environments and the expression of virulence factors . As a globally disseminated opportunistic pathogen, K. pneumoniae requires efficient energy production to establish and maintain infections, particularly in healthcare settings where it poses significant clinical challenges.

Potential as a Drug Target

Given its essential role in bacterial energy metabolism, ATP synthase has emerged as a potential target for antimicrobial development. Several factors make it an attractive target:

  1. Essential function for bacterial survival

  2. Structural differences between bacterial and human ATP synthases that could allow for selective targeting

  3. Surface accessibility of certain portions of the complex

  4. Precedent for targeting ATP synthase in other organisms

Recent research has highlighted ATP synthase components as potential targets for novel antimicrobials against K. pneumoniae and related bacterial pathogens, particularly in light of increasing antibiotic resistance . The global emergence and spread of resistant strains underline the need for novel antimicrobials against K. pneumoniae, and ATP synthase components represent promising candidates for such development.

Basic Research Applications

Recombinant K. pneumoniae atpB protein serves as a valuable tool for various basic research applications that enhance our understanding of bacterial physiology:

  • Structural studies to elucidate the architecture of bacterial ATP synthases

  • Functional assays to investigate energy coupling mechanisms

  • Antibody production for detection and localization studies

  • Protein-protein interaction studies to map ATP synthase assembly

These fundamental investigations contribute to our understanding of bacterial bioenergetics and may reveal unique features of K. pneumoniae energy metabolism that could be exploited for therapeutic purposes.

Diagnostic and Immunological Applications

ATP synthase subunits have shown potential as diagnostic markers and immunological targets in various bacterial species. Similar to the approach used with M. pneumoniae ATP synthase beta subunit (AtpD), which was identified by serologic proteome analysis as a promising diagnostic antigen , K. pneumoniae atpB might serve similar purposes.

Potential applications include:

  • Development of serological assays for detecting K. pneumoniae infections

  • Screening for anti-ATP synthase antibodies in patient samples

  • Evaluation of immune responses to K. pneumoniae

  • Structure-based drug design targeting ATP synthase

The ATP synthase components of bacteria often elicit strong immune responses during infection, making them potentially valuable targets for diagnostic and immunological applications .

Antimicrobial Resistance Considerations

K. pneumoniae strains that produce extended-spectrum β-lactamases have become increasingly prevalent, limiting treatment options for infections caused by this pathogen . Many strains exhibit multidrug resistance, necessitating the use of "last-resort" antibiotics such as polymyxins .

In this context, research into novel targets, including ATP synthase components like atpB, has gained importance. An integrative, multi-omics approach for prioritizing Klebsiella pneumoniae drug targets has highlighted proteins involved in essential metabolic processes as promising candidates for antimicrobial development . Understanding the structure and function of atpB may contribute to the development of new antimicrobial strategies that could potentially overcome existing resistance mechanisms.

Reconstitution Procedures

For experimental use, lyophilized atpB requires reconstitution. A typical reconstitution procedure involves:

  1. Centrifuging the vial briefly prior to opening to bring contents to the bottom

  2. Reconstituting the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Adding glycerol (typically to a final concentration of 5-50%) for long-term storage

  4. Aliquoting the reconstituted protein to minimize freeze-thaw cycles

Detailed reconstitution protocols are usually provided by manufacturers and may vary depending on the specific preparation and intended application . The addition of glycerol serves as a cryoprotectant for frozen storage, helping to maintain protein integrity.

Stability and Quality Control

Several factors can affect the stability of recombinant atpB:

  • Temperature fluctuations

  • Repeated freeze-thaw cycles

  • Exposure to proteases

  • pH changes

  • Oxidation

To maximize stability, the protein is typically stored in a buffer containing stabilizing agents such as trehalose (6%), which helps maintain protein structure during lyophilization and storage . Quality control measures, including SDS-PAGE analysis to confirm purity (>90%), are essential for ensuring the reliability of experimental results using this recombinant protein.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
atpB; KPK_5538; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Klebsiella pneumoniae (strain 342)
Target Names
atpB
Target Protein Sequence
MASENMTPQDYIGHHLNNLQLDLRTFSLVDPHNHTATFWTLNIDSMFFSVVLGLLFLAMF RSVAKKATSGVPGKFQTFIEMIIGFVHGSVKDMYHGKSKVIAPLALTVFVWVFLMNLMDL LPIDLLPYIGEHIFGLPALRVVPSADVNITLSMALGVFILIIFYSIKMKGVGGFVKELTM QPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWVLNVP WAIFHILIITLQAFIFMVLTIVYLSMASEEH
Uniprot No.

Target Background

Function
Klebsiella pneumoniae ATP synthase subunit a (atpB) is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Database Links

KEGG: kpe:KPK_5538

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of ATP synthase subunit a (atpB) in Klebsiella pneumoniae?

Subunit a (atpB) in K. pneumoniae ATP synthase plays a critical role in ion translocation across the membrane, forming part of the membrane-embedded F₀ sector. Unlike many other bacterial ATP synthases that use protons as coupling ions, evidence suggests that K. pneumoniae complex I utilizes sodium ions as the exclusive coupling ion . The atpB subunit contains the channel through which these ions flow, creating an electrochemical gradient that drives the rotary mechanism of ATP synthesis.

The protein functions within a larger complex that couples the electrochemical gradient to conformational changes in the F₁ catalytic sector, enabling the phosphorylation of ADP to ATP. In reconstituted systems, this sodium ion gradient established during NADH oxidation has been demonstrated to drive ATP synthesis from ADP and phosphate .

How does the isolation of functional atpB differ from other ATP synthase subunits?

Isolation of functional atpB presents unique challenges compared to other ATP synthase subunits due to its hydrophobic nature and membrane integration. Successful isolation requires:

  • Selection of appropriate detergents that maintain protein stability without disrupting critical structural features

  • Careful consideration of lipid environments that support native protein conformation

  • Temperature control throughout purification to prevent aggregation

Unlike soluble components of the F₁ sector, atpB requires membrane mimetics during all purification steps. For functional studies, reconstitution into proteoliposomes has proven effective, as demonstrated in experiments where K. pneumoniae complex I was successfully coupled with ATP synthase from I. tartaricus in a reconstituted system . This approach allowed researchers to observe the establishment of sodium ion gradients during NADH oxidation.

What expression systems are most suitable for recombinant K. pneumoniae atpB production?

The optimal expression system depends on research objectives:

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yields, genetic similarity to K. pneumoniae, established protocolsPotential inclusion body formationStructural studies, antibody production
Cell-free systemsAvoids toxicity issues, direct incorporation into liposomesLower yields, higher costFunctional studies requiring direct membrane insertion
Homologous expressionNative post-translational modifications, proper foldingMore challenging genetic manipulationStudies of protein-protein interactions within the complex

For functional studies, E. coli C41(DE3) or C43(DE3) strains engineered for membrane protein expression often provide the best balance between yield and proper folding. Codon optimization should account for the high GC content typical of Klebsiella genes. The addition of fusion partners like MBP or SUMO can improve solubility, though these must be removed for functional assays.

How does the ion specificity of K. pneumoniae ATP synthase compare with other bacterial homologs?

The ion specificity of K. pneumoniae ATP synthase represents a fascinating divergence from many other bacterial ATP synthases. Research indicates that K. pneumoniae complex I uses Na⁺ as its exclusive coupling ion, rather than the more common H⁺ . This characteristic has significant implications for energy conservation strategies in this pathogen.

In reconstituted proteoliposome systems containing K. pneumoniae complex I and I. tartaricus ATP synthase, researchers observed:

  • Establishment of an electrochemical sodium gradient during NADH oxidation

  • Utilization of this Na⁺ gradient to drive ATP synthesis

  • Absence of detectable NADH-driven proton transport into proteoliposomes

  • Capability for reverse electron transfer when a sufficient transmembrane voltage (>30 mV) was present

These findings contrast with most model bacterial systems like E. coli, where protons serve as the primary coupling ion. Further investigations into the amino acid residues within atpB that determine this ion specificity would provide valuable insights into the evolutionary adaptations of K. pneumoniae energy metabolism.

What experimental approaches can differentiate between Na⁺-coupled and H⁺-coupled ATP synthesis?

Distinguishing between Na⁺-coupled and H⁺-coupled ATP synthesis requires carefully designed experiments:

  • Ion gradient manipulation: Establishing defined Na⁺ or H⁺ gradients across membranes containing reconstituted ATP synthase can reveal which ion drives ATP synthesis. For example, acidified thylakoids transferred to media with lower proton concentration demonstrated ATP synthesis driven by proton movement in chemiosmotic experiments .

  • Specific inhibitors: Compounds like EIPA (5-(N-ethyl-N-isopropyl)amiloride) selectively inhibit Na⁺ transport without affecting H⁺ transport.

  • Isotope exchange studies: Using ²²Na⁺ or tritiated water to track ion movement during ATP synthesis.

  • Site-directed mutagenesis: Modifying conserved residues in atpB that coordinate ion binding can reveal which ions are essential for function.

  • Biophysical measurements: Direct measurement of ion fluxes using fluorescent probes (SBFI for Na⁺, BCECF for H⁺) can correlate ion movement with ATP synthesis activity.

In studies with K. pneumoniae complex I, the absence of NADH-driven proton transport into proteoliposomes, coupled with the observation of Na⁺-dependent ATP synthesis, provided compelling evidence for exclusive Na⁺ coupling .

How do mutations in atpB affect the coupling efficiency of ATP synthesis?

Mutations in atpB can significantly alter the coupling efficiency between ion translocation and ATP synthesis. Key effects include:

  • Ion selectivity changes: Mutations in the ion channel region can alter the preference between Na⁺ and H⁺, affecting the coupling ion used.

  • Proton/sodium leak: Some mutations create uncoupled pathways, allowing ions to flow without driving ATP synthesis, reducing efficiency.

  • Altered c-ring interaction: Since atpB interfaces with the rotating c-ring, mutations can affect the mechanical coupling between ion movement and rotary motion.

  • Stator stability impacts: As part of the stator structure, mutations in atpB can destabilize the entire complex, as observed in studies of ATP synthase assembly where absence of stator components led to complex disassembly .

Experimental approaches to studying these effects include:

  • Reconstitution of mutant proteins in proteoliposomes for direct measurement of ATP synthesis rates

  • Membrane potential measurements to assess ion leakage

  • Structural studies to correlate mutations with conformational changes

  • Molecular dynamics simulations to predict effects of specific residue alterations

What protocol yields optimal reconstitution of K. pneumoniae atpB into functional proteoliposomes?

For optimal reconstitution of K. pneumoniae atpB into functional proteoliposomes, the following methodology has proven effective:

  • Lipid preparation:

    • Mix E. coli polar lipids with phosphatidylcholine (7:3 ratio)

    • Dissolve in chloroform, evaporate under nitrogen, and resuspend in buffer (10 mM HEPES-KOH pH 7.5, 2.5 mM MgCl₂)

    • Sonicate to form unilamellar vesicles

  • Protein incorporation:

    • Add purified atpB (or complete ATP synthase) at a protein:lipid ratio of 1:50-100 (w/w)

    • Destabilize preformed liposomes with detergent (Triton X-100 or C₁₂E₈) at just above critical micelle concentration

    • Incubate 30 minutes at room temperature with gentle agitation

  • Detergent removal:

    • Add Bio-Beads SM-2 in sequential steps (first addition: 30 mg/ml, incubate 1 hour; second addition: 60 mg/ml, incubate 2 hours; third addition: 60 mg/ml, overnight at 4°C)

    • Alternatively, use controlled dialysis against detergent-free buffer

  • Proteoliposome collection:

    • Centrifuge at 200,000 × g for 30 minutes

    • Resuspend pellet in assay buffer

This protocol has been successfully employed in experiments demonstrating sodium ion cycling between complex I from K. pneumoniae and ATP synthase in reconstituted systems . For functional validation, ATP synthesis assays can be performed by establishing a sodium ion gradient across the proteoliposome membrane.

How can researchers measure Na⁺-dependent ATP synthesis activity in reconstituted systems?

Measuring Na⁺-dependent ATP synthesis requires careful experimental design to establish and monitor sodium gradients:

  • Gradient establishment:

    • Preincubate proteoliposomes in buffer containing 100-200 mM NaCl

    • Rapidly dilute into Na⁺-free buffer with equivalent osmolarity (using choline chloride or KCl)

    • Alternatively, use valinomycin/K⁺ to establish a membrane potential

  • ATP synthesis assay:

    • Add ADP (2 mM) and Pi (5 mM) to the external medium

    • Incubate at 30°C for defined time intervals (30 seconds to 5 minutes)

    • Stop reaction with trichloroacetic acid (5% final concentration)

  • ATP quantification:

    • Use luciferin/luciferase assay for high sensitivity

    • Alternatively, use coupled enzyme assays (hexokinase/glucose-6-phosphate dehydrogenase) with spectrophotometric detection

  • Controls to include:

    • Gramicidin to dissipate Na⁺ gradient (negative control)

    • Parallel experiments substituting K⁺ or H⁺ gradients to assess ion specificity

    • Proteoliposomes without reconstituted protein

In studies with K. pneumoniae complex I and I. tartaricus ATP synthase, this approach demonstrated that the Na⁺ gradient established during NADH oxidation could drive ATP synthesis from ADP and phosphate . Additionally, reverse electron transfer experiments showed that the electrochemical sodium gradient generated by ATP hydrolysis could drive NADH formation, but only when the transmembrane voltage exceeded 30 mV .

What approaches are effective for studying atpB interactions with other ATP synthase subunits?

Several complementary techniques are particularly effective for investigating interactions between atpB and other ATP synthase subunits:

  • Crosslinking studies:

    • Chemical crosslinkers with varying spacer arm lengths can capture interactions

    • Photo-activatable crosslinkers allow more specific targeting

    • Zero-length crosslinkers (carbodiimides) identify direct contacts

  • Co-immunoprecipitation approaches:

    • Epitope-tagged versions of atpB can be used to pull down interacting partners

    • This approach has successfully identified interactions between ATP synthase subunits in apicomplexan parasites

    • Antibodies against native atpB can be used to immunocapture the intact complex

  • Genetic approaches:

    • Suppressor mutation analysis can identify compensatory mutations in other subunits

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Cysteine scanning mutagenesis coupled with disulfide crosslinking

  • Structural biology methods:

    • Cryo-EM of intact complexes provides visualization of subunit interfaces

    • Mass spectrometry of crosslinked complexes identifies specific contact points

    • Hydrogen-deuterium exchange mass spectrometry reveals protected interfaces

When studying K. pneumoniae atpB, special consideration should be given to its role in the stator structure and its interaction with the c-ring, as these elements are critical for energy coupling.

How can researchers address protein aggregation during recombinant atpB expression?

Protein aggregation is a common challenge when expressing hydrophobic membrane proteins like atpB. Effective strategies include:

  • Expression optimization:

    • Reduce induction temperature to 18-20°C

    • Use weaker promoters or lower inducer concentrations

    • Express in specialized strains like C41(DE3) designed for membrane proteins

  • Solubilization approaches:

    • Screen multiple detergents (DDM, LMNG, LDAO) at various concentrations

    • Add stabilizing agents like glycerol (10%) or specific lipids

    • Use native-source lipids during extraction

  • Fusion partner strategies:

    • N-terminal fusion with MBP or SUMO can improve solubility

    • C-terminal GFP fusion allows monitoring of proper folding

    • TEV or SUMO protease cleavage sites for tag removal

  • Co-expression options:

    • Co-express with natural partner subunits to promote complex assembly

    • Include molecular chaperones (GroEL/ES, DnaK/J) to assist folding

    • Co-express with specific lipid biosynthesis enzymes

When conventional approaches fail, cell-free expression systems offer an alternative that allows direct incorporation into nanodiscs or liposomes, bypassing the aggregation-prone solubilization step.

What strategies help resolve discrepancies in ATP synthesis rate measurements?

Discrepancies in ATP synthesis measurements can arise from multiple factors. Systematic troubleshooting approaches include:

  • Experimental standardization:

    • Precisely control temperature, as even small variations significantly affect enzyme kinetics

    • Standardize protein:lipid ratios in reconstitution

    • Carefully control ion gradients across membranes

  • Technical considerations:

    • Validate ATP detection methods with known standards

    • Account for background ATP contamination in reagents

    • Consider ATPase activity that may mask synthesis

  • Sample preparation factors:

    • Assess protein orientation in membranes (inside-out vs. right-side-out)

    • Quantify actual protein incorporation efficiency

    • Verify integrity of reconstituted proteoliposomes

  • Analysis approaches:

    • Use initial rate measurements to avoid gradient dissipation effects

    • Apply appropriate controls (uncouplers, specific inhibitors)

    • Consider statistical approaches for replicate analysis

In studies of K. pneumoniae complex I, researchers demonstrated conclusively that Na⁺ was used as the exclusive coupling ion . Contradictory results in similar systems might arise from subtle differences in experimental setup or from contaminating ion transport pathways.

How might studies of K. pneumoniae atpB inform therapeutic approaches targeting ATP synthase?

Research on K. pneumoniae atpB has significant implications for developing targeted therapeutics:

  • Exploiting unique ion specificity:

    • The Na⁺ coupling of K. pneumoniae ATP synthase differs from human mitochondrial ATP synthase (H⁺ coupled)

    • This difference creates an opportunity for selective inhibition

    • Compounds that specifically block Na⁺ binding sites could selectively target bacterial energy production

  • Targeting unique structural features:

    • Detailed structural characterization of atpB could reveal bacterial-specific regions

    • Regions involved in stator assembly represent potential targets, as demonstrated by the essentiality of stator components in apicomplexan parasites

    • Small molecules disrupting crucial subunit interactions could destabilize the complex

  • Metabolic considerations:

    • K. pneumoniae shows distinctive metabolic adaptations linked to energy production

    • Understanding connections between ATP synthase function and metabolic flexibility, as observed with the citrate synthase gene (gltA) , could reveal synergistic targets

    • Combined targeting of ATP synthesis and specific metabolic pathways may overcome compensatory mechanisms

  • Resistance mechanisms:

    • Studies of natural variations in atpB sequence across clinical isolates may reveal adaptations affecting drug binding

    • Understanding such mechanisms proactively can inform inhibitor design strategies

The demonstrated importance of ATP synthase function for pathogen viability, as shown in studies where disruption of stator components led to parasite death , underscores the potential of this complex as a therapeutic target.

What unresolved questions exist regarding the evolutionary significance of Na⁺-coupled ATP synthesis in K. pneumoniae?

Several fascinating evolutionary questions remain regarding Na⁺-coupled ATP synthesis in K. pneumoniae:

Addressing these questions will require comparative genomic approaches, biochemical characterization across species, and ecological studies examining K. pneumoniae in its natural environments and host associations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.