Recombinant Klebsiella pneumoniae ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; KPK_5540; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Klebsiella pneumoniae (strain 342)
Target Names
atpF
Target Protein Sequence
MNMNATILGQAIAFVIFVWFCMKYVWPPLMAAIEKRQKEISDGLASAERAKKDLDLAQAN ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIDAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP in the presence of a proton or sodium gradient. These enzymes comprise two domains: the F1 domain, containing the extramembrane catalytic core; and the F0 domain, containing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled, via a rotary mechanism of the central stalk subunits, to proton translocation. This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 and F0.

Database Links

KEGG: kpe:KPK_5540

Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

How does atpF contribute to energy metabolism in K. pneumoniae?

The atpF protein plays a crucial role in K. pneumoniae energy metabolism by supporting the structure and function of the ATP synthase complex. ATP synthase is the final enzyme in oxidative phosphorylation, using the energy from the proton gradient to synthesize ATP.

The process involves:

  • Protons flow through the F0 sector (where atpF is located) down their concentration gradient

  • This proton flow drives rotation of the c-ring within the membrane

  • The peripheral stalk (containing atpF) prevents counter-rotation of the α3β3 headpiece

  • The rotational energy is transferred to the F1 sector catalytic sites

  • ATP is synthesized from ADP and inorganic phosphate

In K. pneumoniae, energy metabolism is particularly important for pathogenesis. Studies have shown that metabolic enhancement through factors like acyltransferase atf3 provides significant growth advantages in vivo by increasing NADH:ubiquinone oxidoreductase transcription and ATP generation . As the enzyme responsible for ATP production, ATP synthase (including atpF) likely plays a key role in this enhanced metabolic state.

What experimental approaches can be used to study atpF function in K. pneumoniae?

Multiple experimental approaches can be employed to investigate atpF function in K. pneumoniae:

Genetic approaches:

  • CRISPR-Cas9 gene editing to create atpF knockouts or introduce specific mutations

  • Lambda Red recombineering for precise genome modifications, as has been successfully used for other K. pneumoniae genes

  • Complementation studies with wild-type or mutant atpF to verify phenotypes

  • In vivo competition assays to assess the impact of atpF modifications on bacterial fitness

Biochemical approaches:

  • Recombinant expression and purification of atpF for in vitro studies

  • ATP synthesis/hydrolysis assays using membrane vesicles or reconstituted systems

  • Crosslinking studies to map protein-protein interactions within the ATP synthase complex

  • Site-directed spin labeling and EPR spectroscopy to examine structural dynamics

Structural approaches:

  • Cryo-electron microscopy of the ATP synthase complex

  • X-ray crystallography of individual domains or the complete complex

  • Nuclear magnetic resonance for studying specific domains or interactions

Physiological approaches:

  • Growth studies under different energy conditions

  • Measurements of membrane potential using fluorescent probes

  • Oxygen consumption assays to assess respiratory function

  • Virulence assessment in animal models comparing wild-type and atpF mutants

These approaches can be combined to develop a comprehensive understanding of atpF's role in K. pneumoniae energy metabolism and pathogenesis.

What are the optimal conditions for expressing recombinant K. pneumoniae atpF in E. coli?

Optimizing expression of recombinant K. pneumoniae atpF in E. coli requires careful consideration of multiple parameters:

ParameterRecommended Conditions
E. coli strainBL21(DE3), Rosetta, or C41/C43 (specialized for membrane proteins)
Expression vectorpET with T7 promoter
Growth mediumLB or 2xYT with appropriate antibiotics
Induction OD6000.6-0.8
IPTG concentration0.1-0.5 mM (lower for membrane proteins)
Induction temperature16-25°C (lower temperatures improve folding)
Induction time4-16 hours
Cell lysisMechanical disruption with detergents
Initial purificationNi-NTA affinity chromatography for His-tagged protein

Based on published protocols for recombinant K. pneumoniae atpF, the protein can be expressed with an N-terminal His-tag in E. coli . Lower induction temperatures (16-18°C) are often beneficial for membrane protein expression, as they slow protein synthesis and improve folding. The addition of glycerol (0.5-1%) to the culture medium can also help stabilize membrane proteins.

After expression, cells should be lysed in buffer containing appropriate detergents (e.g., n-dodecyl-β-D-maltoside or Triton X-100) to solubilize the membrane-associated protein. Purification can be performed using Ni-NTA affinity chromatography, followed by size exclusion chromatography to remove aggregates and impurities .

How can researchers verify the functional integrity of purified recombinant atpF?

Verifying the functional integrity of purified recombinant atpF requires multiple complementary approaches:

Structural integrity assessments:

  • Circular dichroism (CD) spectroscopy to confirm proper secondary structure

  • Fluorescence spectroscopy to assess tertiary structure

  • Size exclusion chromatography to ensure the protein is not aggregated

  • Thermal shift assays to measure protein stability

Functional assays:

  • ATP synthase reconstitution experiments combining purified atpF with other subunits

  • Measurement of ATP synthesis activity in proteoliposomes containing reconstituted complexes

  • Proton translocation assays using pH-sensitive fluorescent dyes

Interaction studies:

  • Surface plasmon resonance to measure binding to other ATP synthase subunits

  • Pull-down assays to verify interactions with partner proteins

  • Native gel electrophoresis to assess complex formation

Complementation studies:

  • Expression of the recombinant atpF in an atpF-null K. pneumoniae strain

  • Assessment of ATP synthesis restoration

  • Growth phenotype analysis under different metabolic conditions

A combination of these approaches provides comprehensive validation of the recombinant protein's functional integrity. For long-term storage, purified atpF should be kept in buffer containing stabilizers such as glycerol (5-50%) or trehalose (6%) at -20°C to -80°C to maintain its functional properties .

How does ATP synthase function relate to K. pneumoniae virulence and pathogenesis?

ATP synthase function, including the role of atpF, likely contributes significantly to K. pneumoniae virulence and pathogenesis through several mechanisms:

Energy provision for virulence factor production:

K. pneumoniae virulence factors, including capsular polysaccharides, require substantial energy for synthesis. Research has shown that capsule production is a major determinant of hypervirulent K. pneumoniae (hvKP) pathogenicity . The ATP generated by ATP synthase provides the energy needed for these biosynthetic processes.

Metabolic adaptation during infection:

Studies have demonstrated that metabolic enhancement provides K. pneumoniae with competitive advantages in vivo. For example, the acquisition of the acyltransferase atf3 in ST258 strains increases NADH:ubiquinone oxidoreductase transcription and ATP generation, fueled by increased glycolysis . This metabolic boost leads to greater consumption of glucose in the host airway and increased bacterial burden in the lung.

Adaptation to host environments:

Different infection sites present distinct metabolic challenges. The citrate synthase gene gltA has been shown to influence site-specific fitness, being required for lung infection and gut colonization but dispensable in the bloodstream . ATP synthase function might similarly be differentially important in various host environments.

Potential connections to antibiotic resistance:

Energy-dependent processes like efflux pump activity are important mechanisms of antibiotic resistance in K. pneumoniae. ATP synthase function could indirectly influence resistance by affecting the energy available for these processes.

While direct evidence linking atpF specifically to virulence is limited, these connections between energy metabolism and pathogenesis suggest that ATP synthase components, including atpF, likely play important roles in K. pneumoniae infection.

What is the relationship between K. pneumoniae atpF and bacterial adaptation to stress conditions?

ATP synthase components, including atpF, likely play crucial roles in K. pneumoniae adaptation to various stress conditions encountered during infection:

Acid stress adaptation:

When K. pneumoniae encounters acidic environments (such as in the stomach or phagolysosome), ATP synthase can work in reverse to pump protons out of the cell, helping maintain cytoplasmic pH homeostasis. Changes in atpF expression or function could influence this adaptive response.

Nutrient limitation:

Under nutrient-limited conditions, efficient energy generation becomes critical for survival. Research shows that K. pneumoniae citrate synthase (gltA) is necessary for growth in amino acid-limited bronchioloalveolar lavage fluid but dispensable in amino acid-rich serum . ATP synthase function may similarly be differentially important depending on nutrient availability.

Oxidative stress:

During infection, K. pneumoniae encounters reactive oxygen species produced by host immune cells. ATP synthase activity affects the cellular redox state, potentially influencing resistance to oxidative stress. Research has shown that NQOs (NADH:quinone oxidoreductases) in K. pneumoniae promote bacterial growth by generating a more favorable intracellular redox state .

Antibiotic stress:

K. pneumoniae can develop resistance through prolonged exposure to sub-MIC levels of antibiotics, with metabolic changes often accompanying resistance development . ATP synthase function may adapt during this process, potentially affecting the energy required for resistance mechanisms.

Understanding how atpF and other ATP synthase components respond to these stresses could provide insights into K. pneumoniae pathogenesis and potentially identify new therapeutic targets.

How do atpF mutations affect ATP synthesis efficiency and bacterial fitness?

Mutations in atpF could affect ATP synthesis efficiency and bacterial fitness through several mechanisms:

Functional consequences:

  • Reduced ATP synthesis capacity, limiting energy available for growth and virulence

  • Altered proton leakage, potentially affecting the proton motive force

  • Changes in ATP synthase regulation under different metabolic conditions

Fitness effects:

  • Growth defects, particularly under energy-limited conditions

  • Altered competitive ability during infection

  • Potential compensatory metabolic adaptations

Research methodologies to investigate these effects include:

  • Site-directed mutagenesis to create specific atpF variants

  • ATP synthesis assays using inverted membrane vesicles

  • Growth competition experiments under various conditions

  • Structural analysis of mutant proteins

  • In vivo infection models comparing wild-type and mutant strains

While specific data on atpF mutations in K. pneumoniae is limited, studies of other bacteria suggest that ATP synthase mutations can significantly impact bacterial fitness and virulence. For example, in K. pneumoniae, mutations affecting metabolism (such as in the acyltransferase atf3) can provide significant competitive advantages in vivo , suggesting that changes in energy metabolism components like atpF could similarly affect fitness.

What assays can be used to measure ATP synthase activity in K. pneumoniae?

Several complementary assays can be used to measure ATP synthase activity in K. pneumoniae:

Assay TypeMethodMeasurementAdvantages
ATP synthesisLuciferase-based luminescenceATP productionDirect measure of synthesis activity
Proton translocationpH-sensitive fluorescent dyesH+ movementAssesses proton pumping function
ATPase activityNADH-coupled spectrophotometryATP hydrolysisHigh sensitivity, continuous monitoring
Membrane potentialVoltage-sensitive dyesΔΨ changesMeasures energetic consequences
Oxygen consumptionClark-type electrodeRespiratory activityAssesses coupled respiration

Detailed methodologies:

  • ATP synthesis assay:

    • Prepare inverted membrane vesicles from K. pneumoniae

    • Energize vesicles with NADH or succinate to establish proton gradient

    • Add ADP and Pi, then measure ATP production using luciferase

    • Specific inhibitors (e.g., oligomycin) confirm ATP synthase specificity

  • ATPase activity:

    • Measure ATP hydrolysis using:

      • Malachite green assay to detect released phosphate

      • Enzyme-coupled assay linking ATP hydrolysis to NADH oxidation

      • pH changes using pH indicators like phenol red

  • Proton pumping:

    • Load membrane vesicles with pH-sensitive fluorescent dyes (ACMA, pyranine)

    • Add ATP to initiate proton pumping

    • Monitor fluorescence changes as protons move across the membrane

  • Whole-cell approaches:

    • Measure cellular ATP levels using luciferase-based assays

    • Assess membrane potential using fluorescent probes (DiSC3)

    • Monitor oxygen consumption as an indicator of respiratory activity

These assays can be performed under various conditions to understand how factors like pH, temperature, or metabolic state affect ATP synthase function in K. pneumoniae.

How does K. pneumoniae atpF compare to homologous proteins in other bacterial species?

K. pneumoniae atpF shares significant structural and functional similarities with homologous proteins in other bacterial species, particularly within the Enterobacteriaceae family, while also possessing some unique characteristics:

Sequence conservation:

Based on patterns observed in other K. pneumoniae proteins, atpF likely shares high sequence identity with homologs in related species. For example, K. pneumoniae citrate synthase (GltA) shares 96% and 95% amino acid sequence identity with S. enterica and E. coli citrate synthases, respectively . This high conservation reflects the fundamental importance of ATP synthase in bacterial energy metabolism.

Structural features:

The core structural features of atpF are likely conserved across species:

  • N-terminal membrane-spanning domain

  • C-terminal cytoplasmic domain forming part of the peripheral stalk

  • Key interaction interfaces with other ATP synthase subunits

Functional similarities:

The basic function of atpF as part of the peripheral stalk of ATP synthase is conserved across bacteria. This includes:

  • Preventing counter-rotation of the α3β3 headpiece during catalysis

  • Contributing to the structural stability of the ATP synthase complex

  • Participating in the assembly of the complete enzyme complex

Species-specific adaptations:

K. pneumoniae atpF may have subtle adaptations reflecting the organism's specific metabolic requirements and environmental niches:

  • Amino acid variations affecting protein stability or interactions

  • Regulatory differences in gene expression under specific conditions

  • Potential post-translational modifications unique to K. pneumoniae

Understanding these similarities and differences is valuable for identifying potential antimicrobial targets that might specifically affect K. pneumoniae without disrupting host ATP synthase or beneficial microbiota.

What role might ATP synthase play in K. pneumoniae resistance to antimicrobial agents?

ATP synthase, including the atpF subunit, may contribute to K. pneumoniae antimicrobial resistance through several direct and indirect mechanisms:

Energy-dependent resistance mechanisms:

  • Efflux pump activity: Many efflux pumps are ATP-dependent and require energy from ATP synthase to expel antibiotics from the cell. K. pneumoniae possesses numerous efflux systems that contribute to multidrug resistance.

  • Drug modification enzymes: The production and activity of enzymes that inactivate antibiotics (such as β-lactamases) require energy provided by ATP synthase.

  • Cell wall synthesis: Maintaining cell wall integrity against antibiotics like β-lactams requires energy-dependent processes.

Metabolic adaptations:

Studies show that K. pneumoniae can develop resistance through prolonged exposure to sub-MIC levels of antibiotics, with metabolic changes often accompanying resistance development . After extended exposure to cephalothin, K. pneumoniae exhibits:

  • Clinical resistance to both cephalothin and tetracycline

  • Altered cellular and colony morphology

  • A highly mucoid phenotype

  • Mutations in regulatory genes that affect metabolism

Bacterial persistence:

ATP synthase activity may be modulated during the formation of persister cells—metabolically quiescent bacteria that survive antibiotic treatment. Reduced ATP synthase activity can lead to decreased metabolism, potentially contributing to antibiotic tolerance.

Potential as a drug target:

Paradoxically, ATP synthase itself can be a target for antimicrobial agents. Compounds that inhibit ATP synthase could potentially be developed as novel therapeutics against K. pneumoniae, particularly for drug-resistant strains where traditional antibiotics are ineffective.

Understanding the relationship between ATP synthase function and antimicrobial resistance could lead to new strategies for combating resistant K. pneumoniae infections.

How can researchers overcome challenges in studying membrane proteins like atpF?

Studying membrane proteins like atpF presents significant challenges due to their hydrophobicity, flexibility, and requirement for a lipid environment. Researchers can employ several strategies to overcome these difficulties:

Expression and purification challenges:

  • Specialized expression systems:

    • Use E. coli strains optimized for membrane protein expression (C41/C43, Lemo21)

    • Consider cell-free expression systems that can directly incorporate detergents or lipids

    • Explore expression in Pichia pastoris for complex eukaryotic-like membrane proteins

  • Solubilization strategies:

    • Screen multiple detergents (DDM, LDAO, digitonin) to identify optimal solubilization conditions

    • Use amphipols or nanodiscs to maintain stability after initial solubilization

    • Incorporate native lipids during purification to maintain functional state

Structural characterization approaches:

  • Cryo-electron microscopy:

    • Single-particle analysis for high-resolution structures without crystallization

    • Enables visualization of the protein in a more native-like environment

    • Can capture multiple conformational states

  • X-ray crystallography enhancements:

    • Lipidic cubic phase crystallization

    • Antibody fragment co-crystallization to increase polar surface area

    • Fusion with crystallization chaperones like T4 lysozyme

  • Alternative structural methods:

    • Hydrogen-deuterium exchange mass spectrometry for dynamic structural information

    • Solid-state NMR for membrane proteins in lipid bilayers

    • Cross-linking mass spectrometry to map protein-protein interactions

Functional analysis strategies:

  • Reconstitution systems:

    • Proteoliposomes containing purified components

    • Planar lipid bilayers for electrophysiological measurements

    • Nanodiscs for single-molecule studies

  • Cellular assays:

    • Genetic complementation to verify functionality

    • Fluorescent reporter systems to monitor activity in vivo

    • Membrane potential measurements using voltage-sensitive dyes

These approaches can be combined to develop a comprehensive understanding of atpF structure, function, and interactions within the ATP synthase complex.

What is the relationship between ATP synthase function and hypervirulent K. pneumoniae strains?

Hypervirulent K. pneumoniae (hvKP) strains exhibit enhanced pathogenicity and are associated with invasive infections even in healthy individuals. ATP synthase function likely contributes to hvKP pathogenesis in several important ways:

Energy support for virulence factors:

HvKP strains are characterized by hypercapsule production, which is a major cause of their enhanced pathogenicity . The synthesis of capsular polysaccharides requires significant energy input, which depends on efficient ATP generation by ATP synthase. Research has identified isoferulic acid (IFA) as a capsule inhibitor that suppresses capsule polysaccharide synthesis by "increasing the energy status of bacteria" , highlighting the connection between energy metabolism and capsule production.

Metabolic enhancement:

Studies have shown that certain K. pneumoniae strains (such as ST258) acquire metabolic enhancers like the acyltransferase atf3, which promotes:

  • Increased glycolysis and TCA cycle activity

  • Greater NADH:ubiquinone oxidoreductase transcription

  • Enhanced ATP generation

  • Improved competitive fitness in vivo

ATP synthase function is central to this enhanced metabolic state, as it generates the ATP that provides a significant growth advantage during infection.

Adaptation to host environments:

HvKP strains must adapt to various host environments during invasive infections. ATP synthase function may be particularly important in nutrient-limited environments where efficient energy generation is critical. Research on K. pneumoniae gltA (citrate synthase) shows that metabolic genes can be differentially important depending on the infection site .

Relationship to antimicrobial resistance:

Increasingly concerning are hvKP strains that have acquired carbapenem resistance (CR-hvKP), representing a "perfect storm" of hypervirulence and multidrug resistance . ATP synthase function may play a role in supporting both the virulence and resistance mechanisms in these dangerous strains.

Understanding ATP synthase's contribution to hvKP pathogenesis could potentially identify new therapeutic approaches targeting bacterial energy metabolism.

How can gene editing techniques be used to study atpF function in K. pneumoniae?

Modern gene editing techniques offer powerful approaches for investigating atpF function in K. pneumoniae:

CRISPR-Cas9 system:

CRISPR-Cas9 has been successfully adapted for K. pneumoniae genetic manipulation and offers several advantages:

  • Gene knockout studies:

    • Complete deletion of atpF to assess its essentiality

    • Creation of conditional mutants if atpF is essential

    • Marker-free modifications avoiding antibiotic resistance genes

  • Precise mutations:

    • Introduction of point mutations to study specific residues

    • Domain deletions to assess functional regions

    • Epitope tag insertions for protein localization studies

  • Regulatory element modification:

    • Promoter replacements to control expression levels

    • Introduction of inducible systems for temporal control

    • Modification of transcription factor binding sites

Lambda Red Recombineering:

This technique has been effectively combined with CRISPR-Cas9 in K. pneumoniae and allows:

  • Precise, scarless genome modifications

  • Efficient introduction of heterologous DNA

  • Manipulation of large genomic regions

Base editing and prime editing:

These newer CRISPR derivatives enable:

  • Direct base conversions without double-strand breaks

  • Reduced off-target effects

  • More efficient introduction of specific mutations

Experimental design considerations:

  • Target selection:

    • Use sequence alignments to identify conserved, functionally important residues

    • Target membrane-spanning regions vs. cytoplasmic domains

    • Consider protein-protein interaction interfaces

  • Phenotypic analysis:

    • Growth assays under different energy conditions

    • ATP synthesis/hydrolysis measurements

    • Infection models to assess virulence impacts

  • Genetic validation:

    • Complementation with wild-type atpF

    • Allelic series with different mutations

    • Epistasis analysis with other ATP synthase components

These gene editing approaches, combined with appropriate phenotypic assays, can provide comprehensive insights into atpF function in K. pneumoniae energy metabolism and pathogenesis.

What are the most promising research directions for understanding ATP synthase's role in K. pneumoniae pathogenesis?

Several promising research directions could significantly advance our understanding of ATP synthase's role in K. pneumoniae pathogenesis:

Systems biology approaches:

  • Multi-omics integration:

    • Combined transcriptomics, proteomics, and metabolomics to map energy metabolism changes during infection

    • Network analysis to identify regulatory hubs connecting ATP synthase to virulence factor expression

    • Flux balance analysis to quantify energy allocation during different infection stages

  • Single-cell approaches:

    • Single-cell RNA-seq to identify metabolic heterogeneity within K. pneumoniae populations

    • Time-lapse microscopy with ATP biosensors to track energy dynamics during infection

    • Spatial transcriptomics to map metabolic adaptations in different microenvironments

Host-pathogen interactions:

  • Immune response interactions:

    • Investigation of how ATP synthase activity affects resistance to host defense mechanisms

    • Study of potential ATP synthase inhibitors produced by the host immune system

    • Examination of metabolic competition between K. pneumoniae and host cells

  • Tissue-specific adaptations:

    • Comparison of ATP synthase expression and activity across different infection sites

    • Investigation of how tissue-specific metabolites affect bacterial energy metabolism

    • Development of organ-on-chip models to study site-specific metabolic adaptations

Therapeutic development:

  • ATP synthase as a drug target:

    • High-throughput screening for K. pneumoniae ATP synthase inhibitors

    • Structure-based drug design targeting specific subunits like atpF

    • Development of combination therapies targeting both energy metabolism and virulence factors

  • Metabolic modulation strategies:

    • Compounds that alter host-pathogen metabolic interactions

    • Metabolic sensitizers that make bacteria more susceptible to existing antibiotics

    • Repurposing of existing drugs that affect energy metabolism

Recent research has highlighted promising strategies like targeting K. pneumoniae capsule production by modulating bacterial energy status . Similar approaches focusing specifically on ATP synthase could yield valuable new therapeutic options for combating increasingly resistant and virulent K. pneumoniae infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.