Recombinant Klebsiella pneumoniae Bifunctional protein aas (aas)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics

Genomic Context

Gene IdentifierAssociated Locus/Function
Gene Nameaas
SynonymsKPK_0869, KPN_03245, KPN78578_31820
UniProt IDsB5XUP2 (K. pneumoniae) / A6TDH2 (K. pneumoniae subsp. pneumoniae)

Functional Roles in Bacterial Metabolism

Key Catalytic Processes

Enzymatic ActivitySubstrateFunction in Bacteria
AcyltransferaseAcyl-ACP + phosphoethanolaminePhospholipid remodeling
Acyl-ACP SynthetaseFatty acids + ACPFatty acid activation

Physiological Relevance

  • Phospholipid Synthesis: Essential for constructing bacterial membrane components like phosphatidylethanolamine .

  • Pathogen Survival: Contributes to virulence by maintaining membrane integrity under stress conditions .

Production and Quality Control

Expression and Purification Workflow

  1. Cloning: Full-length aas gene is cloned into E. coli expression vectors.

  2. Induction: Protein expression is induced under optimized conditions.

  3. Purification: Utilizes affinity chromatography via His-tag, followed by SDS-PAGE validation .

Key Quality Metrics

ParameterSpecificationSource
Endotoxin LevelNot reported (n/a) (no data in provided sources)
Activity ValidationFunctional assays requiredInferred from enzyme activity

Research Applications

Experimental Uses

ApplicationDescriptionReference
Enzyme KineticsStudy substrate specificity and catalytic efficiency
Lipid MetabolismModel phospholipid biosynthesis pathways
Immunoassay DevelopmentServes as antigen in ELISA kits for antibody detection

Challenges in Research

  • Strain Variability: Subspecies-specific differences in UniProt IDs (B5XUP2 vs. A6TDH2) may require strain-specific validation .

  • Storage Sensitivity: Lyophilized form requires careful reconstitution to maintain activity .

Data Tables for Reference

Amino Acid Sequence Highlights

RegionSequence Fragment (Partial)Functional Role
N-TerminalMLLGFFRLLFKGLYRVRLTGDTQALYQQK... Membrane localization signal?
Catalytic DomainPCVEDINFQPDTYRKLLTK... Acyltransferase active site

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your required tag type in your order for preferential development.
Synonyms
aas; KPK_0869; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long-chain-fatty-acid--[acyl-carrier-protein] ligase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-719
Protein Length
full length protein
Species
Klebsiella pneumoniae (strain 342)
Target Names
aas
Target Protein Sequence
MLLGFFRLLFKGLYRVRLTGDTQALYQQKVLITPNHVSFLDGILLALFLPVRPVFAVYTS ISQRWFMRALTPIIDFVPLDPTKPMSIKHLVRLIEQGRPVVIFPEGRISVSGSLMKIYDG AAFVAAKSQATIVPLRIDGAELTPFSRLKGLVKRRLFPRIQLHLLPPTHLPMPEAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLAAQDRFGARKPCVEDINFQPDTYRKLLTK TLFVARILEKYSQRGEKIGLMLPNAGISAAVIFGAIARGRIPAMMNYTAGVKGLSSAIAA AEINTIFTSRTFLDKGKLWHLPEQLTQVRWVFLEDLKGDITLADKLWIFGHLLAPRLAQV KQQPEDAAMILFTSGSEGNPKGVVHSHKSLLANVEQIKTIADFTANDRFMSALPLFHSFG LTVGLLTPLFTGAEVFLYPSPLHYRVVPELVYDRNCTVLFGTSTFLANYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKVGTVGRILPGM DARLLAMPGIEQGGRLQLKGPNIMKGYLRVENPGVLEAPAAENQHGEKEAGWYDTGDIVT FDEQGYVRIQGRAKRFAKIAGEMISLEMVEQVALGASPDKMHATAIKQDASKGEALVLFT TDNELTREALLRYARQHGVPELAVPRDIRWLKQLPVLGSGKPDYVTLKNMVDEAETTHE
Uniprot No.

Target Background

Function

This bifunctional protein plays a critical role in lysophospholipid acylation. In the presence of ATP and magnesium, it transfers fatty acids to the 1-position via an enzyme-bound acyl-ACP intermediate. Its physiological function is the regeneration of phosphatidylethanolamine from 2-acyl-glycero-3-phosphoethanolamine (2-acyl-GPE), which is produced through transacylation reactions or phospholipase A1 degradation.

Database Links

KEGG: kpe:KPK_0869

Protein Families
2-acyl-GPE acetyltransferase family; ATP-dependent AMP-binding enzyme family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Klebsiella pneumoniae Bifunctional protein aas (aas)?

Klebsiella pneumoniae Bifunctional protein aas is a 719-amino acid protein that likely plays a dual role in bacterial membrane lipid metabolism. While the specific functions are not fully characterized in the literature, the designation "bifunctional" suggests it performs two distinct enzymatic activities, potentially related to membrane phospholipid remodeling and fatty acid metabolism. The recombinant version typically includes a His-tag to facilitate purification and detection in experimental settings .

How does the aas protein relate to Klebsiella pneumoniae pathogenesis?

While direct evidence linking aas to K. pneumoniae pathogenicity is limited in the provided literature, proteins involved in membrane lipid metabolism often play crucial roles in bacterial adaptation to host environments. K. pneumoniae is a significant cause of nosocomial infections with increasingly common multidrug-resistant phenotypes . Membrane-associated proteins like aas may contribute to the bacterium's ability to survive in diverse host environments and potentially affect its interaction with antimicrobial agents. The aas protein may be particularly important in contexts where membrane remodeling is necessary for stress response during infection.

What expression systems are suitable for recombinant aas protein production?

The recombinant K. pneumoniae Bifunctional protein aas has been successfully expressed in E. coli expression systems with an N-terminal His-tag . This bacterial expression platform is ideal for producing sufficient quantities of the protein for biochemical and structural studies. The available commercial preparation utilizes this approach to generate the full-length protein (amino acids 1-719) fused to an N-terminal His tag . Researchers should consider codon optimization when designing expression constructs to enhance protein yield in E. coli.

What are the recommended storage and handling conditions for recombinant aas protein?

ParameterRecommendationNotes
Long-term storage−20°C/−80°CAliquoting is necessary for multiple use
Short-term storage4°CFor working aliquots, up to one week
FormLyophilized powderRequires reconstitution before use
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0Maintains protein stability
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Brief centrifugation prior to opening recommended
Stabilization5-50% glycerol (final concentration)50% is the default recommendation

Repeated freeze-thaw cycles should be avoided as they can lead to protein degradation and loss of function . For optimal results, researchers should follow these storage guidelines precisely.

What purification methods are most effective for recombinant His-tagged aas protein?

For His-tagged recombinant aas protein, immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resins is the most effective initial purification step. The purification protocol typically involves:

  • Cell lysis under native or denaturing conditions

  • Binding of His-tagged protein to IMAC resin

  • Washing with increasing concentrations of imidazole to remove non-specifically bound proteins

  • Elution with high concentration imidazole buffer

  • Buffer exchange to remove imidazole

For applications requiring higher purity, additional purification steps such as ion exchange chromatography or size exclusion chromatography may be necessary. The commercial preparation of this protein has a purity greater than 90% as determined by SDS-PAGE .

How can recombinant aas protein be used in structural biology studies?

Recombinant K. pneumoniae Bifunctional protein aas can be utilized for various structural biology techniques to determine its three-dimensional structure and functional domains. Approaches include:

The availability of purified recombinant aas protein with a His-tag facilitates these structural studies by providing a consistent source of protein material . Researchers should optimize buffer conditions to enhance protein stability during structural analyses.

What functional assays can be used to characterize the enzymatic activities of aas protein?

Based on its predicted bifunctional nature, several assays can be employed to characterize aas protein activities:

Potential FunctionAssay TypeDetection Method
Acyltransferase activityPhospholipid remodeling assayLC-MS/MS analysis of lipid products
Acyl-ACP synthetase activityATP consumption assayLuciferase-based detection of remaining ATP
Fatty acid activationThin-layer chromatographyRadioactively labeled fatty acid substrates
Membrane integrationLiposome reconstitutionFluorescence-based membrane integrity tests

These assays would need to be optimized specifically for the K. pneumoniae aas protein, as the exact substrates and reaction conditions may differ from homologous proteins in other bacterial species.

How might aas protein contribute to antimicrobial resistance in K. pneumoniae?

K. pneumoniae has been identified as one of the top three pathogens of international concern by the WHO, with approximately 50% of healthcare-associated infections worldwide showing antimicrobial resistance . Membrane lipid metabolism proteins like aas may contribute to this resistance through:

  • Alterations in membrane permeability that restrict antibiotic entry

  • Modifications of lipid A structure affecting interaction with antimicrobial peptides

  • Changes in membrane fluidity influencing the function of membrane-embedded antibiotic efflux pumps

  • Adaptive responses to membrane stress caused by certain antibiotics

Research into these mechanisms could provide valuable insights for developing new strategies to combat antimicrobial resistance in K. pneumoniae infections.

How does the aas protein from K. pneumoniae compare to homologs in other bacterial species?

While specific comparative data is not provided in the search results, bioinformatic analysis would typically reveal evolutionary relationships and functional conservation. Researchers investigating the K. pneumoniae aas protein should consider:

  • Sequence alignment with homologs from other Enterobacteriaceae

  • Domain conservation analysis across bacterial species

  • Phylogenetic analysis to understand evolutionary relationships

  • Functional complementation studies in model organisms

This comparative approach can provide insights into the specific adaptations of the K. pneumoniae aas protein that might relate to its pathogenicity or environmental adaptation.

Could aas protein be a potential target for vaccine development against K. pneumoniae?

Current vaccine development efforts for K. pneumoniae focus on outer membrane proteins and other surface-exposed antigens. A recent study describes a vaccine candidate based on epitope-rich domains of OmpA, OMPK17, and fimb proteins . The potential of aas as a vaccine target would depend on:

  • Its cellular localization and accessibility to antibodies

  • Conservation across different K. pneumoniae strains

  • Immunogenicity and ability to elicit protective antibodies

  • Role in virulence or survival within the host

If aas proves to be surface-exposed or essential for virulence, it could potentially be included in multi-epitope vaccine designs similar to those described for other K. pneumoniae proteins .

What detection methods could incorporate recombinant aas protein for K. pneumoniae identification?

Recombinant proteins can serve as positive controls in detection assays. While the search results describe a recombinase-aided amplification (RAA) assay for hypervirulent K. pneumoniae targeting peg344 and rmpA genes , similar approaches could be developed for aas:

  • PCR-based detection of the aas gene

  • Antibody-based detection methods using anti-aas antibodies

  • Mass spectrometry identification using recombinant aas as a reference

  • Functional biochemical assays specific to aas activity

The high sensitivity (20 copies/reaction) and specificity achieved with RAA for other K. pneumoniae markers suggests this could be a promising approach for aas-based detection as well.

What are the potential applications of aas protein in studying K. pneumoniae pathogenesis?

Future research utilizing recombinant aas protein could explore:

  • Creation of aas knockout strains to evaluate its role in virulence using infection models

  • Development of specific inhibitors targeting aas function as potential antimicrobials

  • Investigation of aas regulation during infection and stress conditions

  • Exploration of aas interaction with host factors during infection

These studies would contribute to our understanding of K. pneumoniae pathogenesis and potentially identify new therapeutic approaches for infections caused by this increasingly drug-resistant pathogen.

How can recombinant aas protein contribute to drug discovery efforts against K. pneumoniae?

The availability of purified recombinant aas protein facilitates several drug discovery approaches:

  • High-throughput screening of compound libraries for inhibitors of aas enzymatic activity

  • Structure-based drug design if crystallographic data becomes available

  • Fragment-based drug discovery to identify initial chemical scaffolds

  • In silico screening followed by biochemical validation

Given the urgent need for new antimicrobials against multidrug-resistant K. pneumoniae , identifying inhibitors of essential bacterial processes involving aas could yield promising drug candidates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.